spacer

EBI Dbfetch

ID   BC057887; SV 1; linear; mRNA; STD; MUS; 4933 BP.
XX
AC   BC057887;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide
DE   5, mRNA (cDNA clone MGC:67946 IMAGE:4983830), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4933
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4933
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8499587853b93cb808cb5cbbd2705a58.
DR   Ensembl-Gn; ENSMUSG00000074892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099497; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113800; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 123 Row: b Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254130.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4933
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="MGC:67946 IMAGE:4983830"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4933
FT                   /gene="B3galt5"
FT                   /note="synonym: b3Galt-V"
FT   misc_difference 123
FT                   /gene="B3galt5"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 178
FT                   /gene="B3galt5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 185
FT                   /gene="B3galt5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   CDS             225..1151
FT                   /codon_start=1
FT                   /gene="B3galt5"
FT                   /product="UDP-Gal:betaGlcNAc beta
FT                   1,3-galactosyltransferase, polypeptide 5"
FT                   /db_xref="GOA:Q9JI67"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:2136878"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI67"
FT                   /protein_id="AAH57887.1"
FT                   /translation="MAHMKTRLVYASILMMGALCLYFSMDSFRELPFVFKKSHGKFLQI
FT                   PDIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEM
FT                   DATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGY
FT                   LTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSD
FT                   VAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVA
FT                   CHFMKPQDLLTYWQALENSKEQDCPAV"
FT   misc_difference 620
FT                   /gene="B3galt5"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 863
FT                   /gene="B3galt5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1139
FT                   /gene="B3galt5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1167
FT                   /gene="B3galt5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1206
FT                   /gene="B3galt5"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1277
FT                   /gene="B3galt5"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1356
FT                   /gene="B3galt5"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 1506
FT                   /gene="B3galt5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1602^1603
FT                   /gene="B3galt5"
FT                   /note="3 bases in the mouse genome, TGT, are not found in
FT                   cDNA."
FT   misc_difference 1726
FT                   /gene="B3galt5"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1739
FT                   /gene="B3galt5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1931
FT                   /gene="B3galt5"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1962
FT                   /gene="B3galt5"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2134
FT                   /gene="B3galt5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2704
FT                   /gene="B3galt5"
FT                   /note="'A' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2735
FT                   /gene="B3galt5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2744
FT                   /gene="B3galt5"
FT                   /note="'T' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2757
FT                   /gene="B3galt5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2871
FT                   /gene="B3galt5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 3264
FT                   /gene="B3galt5"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3649
FT                   /gene="B3galt5"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 3804
FT                   /gene="B3galt5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 3846
FT                   /gene="B3galt5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 4148
FT                   /gene="B3galt5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 4305
FT                   /gene="B3galt5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 4536..4537
FT                   /gene="B3galt5"
FT                   /note="in the mouse genome : GG."
FT   misc_difference 4799
FT                   /gene="B3galt5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 4912..4933
FT                   /gene="B3galt5"
FT                   /note="polyA tail: 22 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4933 BP; 1234 A; 1165 C; 1185 G; 1349 T; 0 other;
     cgcctgcgtc ccctgccctg tcccttctca gctccagcag gacgacgtta tttccgagag        60
     acacaatcat catttttcgg tagataaacc aagtccaaaa ggttatctca gaaggtaatg       120
     tgggacctca ctcaccggct gctctttaaa aggaattcat ttcctcttgg cttctatcct       180
     gtggtttcat cctctggacg aacgtgagct cttactcggc aaagatggct cacatgaaga       240
     caaggctagt ttacgcctcc attctcatga tgggcgcact ctgcttgtac ttcagcatgg       300
     attctttcag agaactcccg tttgttttta agaaaagtca cgggaagttc cttcagattc       360
     cggatataga ctgcaagcag aagccgcctt tcctggtgct gctggtgacg tcatctcaca       420
     agcagctggc cgctcgcatg gccatccgca agacgtgggg tagagagaca tctgtgcagg       480
     gccaacaggt gaggaccttc ttccttctgg ggacctccga cagcaccgag gagatggacg       540
     ccacaaccct ggagagcgag cagcaccgcg acattatcca gaaggacttc aaggatgcct       600
     acttcaacct gaccctgaag accatgatgg gtatggaatg ggtctaccac ttttgtcctc       660
     agacagctta cgtgatgaaa acggactctg acatgtttgt gaatgttggc tatctgacgg       720
     aactgctgct aaagaaaaac aaaacgacca ggttcttcac aggctacata aagccccacg       780
     actttcccat ccggcagaag ttcaacaagt ggtttgtgag taagttcgaa tatccctggg       840
     acaggtaccc acctttttgc tccggtactg gttatgtctt ttccagcgac gtggcgatcc       900
     aagtatacaa cgtctcagag agcgttccgt tcatcaagct ggaggatgtg tttgttgggc       960
     tctgcttggc caagctaaag atccggccgg aggagctgca caccaaacag accttcttcc      1020
     ctggcggttt acgcttttcc gtgtgccgct ttcagaaaat tgtggcatgc cattttatga      1080
     agccccagga cctgctcact tactggcaag cactggagaa ctcgaaagaa caggactgtc      1140
     ctgctgtctg aggggaccct gggggcacct aggacaaact tctgataacc tttggtgatg      1200
     atttgtgacg atctgggatg gtcttgctgg gaactgtctc gggtagagag ccgatgagga      1260
     tgttctcaga gccacagggg aaagggtata tacgaaagct gaggaatgac ttcttcccac      1320
     ttggcacccg gagcaataac agatctcgtt ttttttcagg cctttgcggg atgccctcaa      1380
     tgcttgagac atgcccttca tccacctgtt tcagggctca gcatacatta gaagccctgg      1440
     gtaggttaag agccagcagc cagggtcact tactcgttca aagactcaca gcctgtagac      1500
     gaatcaggaa tgagaatcaa gtggtatcag gattcaattg gtggtcgatc cccaactggg      1560
     tatcccatgc cttgggagaa ggtggtggtg ggagaaattg tgggggggat tcttataact      1620
     aagtagcatc cttcagtcct tttctggggt ctcctgcccc tcacttgtac tttttgaatg      1680
     ttaaggctag gatgaaccgg cttctcaggc cttgcctctt gctcagatga tatagccgag      1740
     cactgagtta atacagatta accacttgat acccaaagtg tcctcagtat gattttagga      1800
     gacatgcatg cctgcagcct ctgtagctca cttccatgct agaaggaacc cggtttatag      1860
     gaccataaaa gtcaggctga caagccgctg ctgagtcttg ctgtgtagac tgactactgc      1920
     taacatcccg gtgagggaga tgtctccact gagccagcac tgcattggat gcactattag      1980
     tgactatttg cagccctggg ggcacttcag acctctaagt tcaaactcaa gggtagccag      2040
     gtacaggcat ggtctgtatg gatacccggg agctttcctg ggccctgggc tgggtctgag      2100
     ctcctgagat acagagccag gaagtaggcc cagcctaggg gctcttcctg aatctgtggt      2160
     ccttaccgac ctcccagaat ttatcatgta gtcgtagaca tgctgagtgt tgccttttgg      2220
     aatttaactt tctattctca gcttagtgtc cctacccctg aaggttttca gagctgggta      2280
     aagacagggg acttatggcc attcatcaga caggtaatct tgctgtgtgt cacaggaatt      2340
     attgctttcc cacagctttt tactcttcta gattttacta tgtgcttggg gcaaagactg      2400
     tgtaattata aatgttggaa tatgctctca cctgaactca ggaaaactta acggtcggaa      2460
     caccgttagg ttggaggaag ctggaagctg cctccggggc ctcattttca cacttgttcc      2520
     tgtctctcct atgaatctct tccacgactc ttggggaaat ttcttctgtc tgtgacatcc      2580
     ttcaaaatca tgcagcacca agttctggac cctcattgag aatatgtgaa attctgaacc      2640
     aggtaaagag aaagggtatt tgttcctggg tgtgtactat ggactacata caccatccaa      2700
     accaaaccca accctacatc ttctttgaca gaggaggaag ccatagcttg taatcatgtg      2760
     gtggtgttgc tatctagagg gtgggagagc tggcatcggc acctagcacc agccaccatg      2820
     tgctagacct tccgtttact cattcattag ccatattgct ctttgcatcc acacatcatg      2880
     aacaaggtca aggttaggtc tgcagagagc agactggatc gagcattcag tgctgagaag      2940
     atggttgggc gtaggtatat gcacagggca ctggagccta agcagatgtg gtcacactta      3000
     ctgttgcatt taagatgcca gcacccctgg caaggggcca tccttcattc ttacaaccag      3060
     attggttgtc cgcagaggca gctgaagtga ctcagtgact catccagcgt cggagacgtg      3120
     gcacagacac aatgctctgt cttctccttt ggtgcactgt ccacatccct ttccatgggc      3180
     ttgcttctct cagaagcttg gggctggtgc taccccagga gtcaccagca tctcactctg      3240
     cctgcacgct gccacttctg accaggctgt tgtcttgagt gttggtctac ttcctggttc      3300
     tgcttgactt cctgtgactt ggccctgggg ttatccgtgg aattctcaca aacctcccat      3360
     ttagactagc cttctcacga ggtcatgtgt ggccaagtct ggcatattga gttcagtcct      3420
     tgagatctgt gtggttgaag gagagaatta atctttacaa gcccgcagtg gcacatatgt      3480
     gcctgcacac atgtgcatgc aaaactgtaa taagtaacat gtaaatgaga caatttttgc      3540
     aaagactcct tcaaacagtg acctctgaag gtctttgctt atttttattt ctgtgttgct      3600
     ctccatgatg caaatccttg tgtgtgaaca ctggcacagg tgtagtagga aaaaaaaacc      3660
     ctctcagtta ggattatttg caaaatgcct tagtttggtt gggaattcaa tagaaaattt      3720
     tgtcagggtc ttgccccagg tctgtctagt tccctacttg ttaatttaac tcccaggata      3780
     agaccctcag agccggcctt agattgatcc tggaggtgaa gggtgaaacc atccaagctc      3840
     agagtcgaga agggctgtgt aagcctgaca ggagcaagtc agagtgaagc aaagtaacaa      3900
     tagcaaaagg ttttaagtcc attaaaagta gcattttcta attaccaggc ataacacttt      3960
     taaatacaag tagaaaatgg attttgtggc caaatgtcat atacctgctt tttttgtgat      4020
     attgttttgt ggtttttggt gctggggatg gagccctaat gcttatcagg gctcccctac      4080
     tgtgcctctc cagccccctg ttgagttgtt tttcaccatg tggtttacta cctcctgcag      4140
     gggtcttagg gatcagagcc tggtgcctcc agttcagatg ctgtgctggg tatttctaac      4200
     tgttaactct ggaagagagt tttaatgaga aattatttct tcattattaa ttgacgtaga      4260
     aagattcagt tcattgtggg cgacactatt ccctaggcag ggtacactaa acagtacgag      4320
     aggagaaagc cagccgaggg caagcaagga tccgtgttta cctctctgtt tgtgagactg      4380
     tggtgtgctc atctgcttca tgttcctgcc ttgacttccc tgcaataaca cactgcaacc      4440
     tggacttgtg agccaaataa accctctctt ccccaagttg attttgtcac agtaacagaa      4500
     gggaagctaa accagatgct caggttgata cctgccagct cagaccacca ggcccttctc      4560
     accctgccct ggatgtcatc cagtgccatc tctctgtccc acacagaggg gagcccagac      4620
     gctgcttaca ttctgcttca gggaaatatc agaggaggag agctgactca tttcacataa      4680
     acaaacaaac aaaaacatgc ctcctatgac tgcaaacaac tcatctgcag ctgcggacac      4740
     tttgtggtca aatttgattt ccaaaaggat taaaaaatta agtgtcactg aatggagtct      4800
     ggaattgtca tttgcctgta tgaggctctg atactgtact tggggagcgg gtatatgtat      4860
     ttatgattta ttaatgatat ttatctttaa taaaaattaa gttataagca gaaaaaaaaa      4920
     aaaaaaaaaa aaa                                                         4933
//


spacer
spacer