spacer

EBI Dbfetch

ID   BC057354; SV 1; linear; mRNA; STD; MUS; 4079 BP.
XX
AC   BC057354;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus oxoglutarate dehydrogenase (lipoamide), mRNA (cDNA clone
DE   MGC:67193 IMAGE:6827509), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4079
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4079
RA   Strausberg R.;
RT   ;
RL   Submitted (02-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; d2c1c6018d2beaf83c905028a27ef4ad.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
CC   Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
CC   Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
CC   Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
CC   Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
CC   Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
CC   Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
CC   George Yang, Scott Zuyderduyn, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 126 Row: n Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4079
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FY0"
FT                   /clone="MGC:67193 IMAGE:6827509"
FT                   /tissue_type="Brain, mouse, 13.5,14.5,16.5,17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4079
FT                   /gene="Ogdh"
FT                   /note="synonym: 2210412K19Rik"
FT   CDS             52..3156
FT                   /codon_start=1
FT                   /product="Ogdh protein"
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /protein_id="AAH57354.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVA
FT                   AEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSL
FT                   ATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQVRGHHIAKLDPLGISCVNFDDAPVT
FT                   VSSNVDLAVFKERLRMLTVGGFYGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLE
FT                   MAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQR
FT                   KWSSEKRFGLEGCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQI
FT                   FCQFDSKLEAADEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKT
FT                   KAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIG
FT                   FTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLV
FT                   CYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNEPEYEEEISKYDKI
FT                   CEEAFTRSKDEKILHIKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSV
FT                   PVENFTIHGGLSRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTF
FT                   SHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVL
FT                   WEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQM
FT                   CNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPK
FT                   SLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKAR
FT                   NMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTID
FT                   RAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS"
FT   misc_feature    193..3126
FT                   /note="SucA; Region: 2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, and related enzymes [Energy
FT                   production and conversion]"
XX
SQ   Sequence 4079 BP; 1002 A; 1076 C; 1041 G; 960 T; 0 other;
     ctcgggtgga gctgaacggg agacaggtac ttgtggaagg ttcaggacaa aatgtttcat        60
     ttaaggactt gtgctgctaa gttaaggcca ttgacagcct cccagactgt taagacattt       120
     tcacaaaaca aaccagcagc aattaggacg tttcaacaga ttcggtgcta ttctgcacct       180
     gtagctgctg aaccatttct tagtgggact agttcgaact atgtggagga aatgtactgt       240
     gcctggttgg agaatcccaa aagtgtacat aagtcatggg acattttttt ccgaaacacc       300
     aatgctggag ccccaccggg cactgcctac cagagccccc tttccctgag tcgaagctcc       360
     ctggctacca tggcccatgc acagtccctg gtggaagcac aacctaacgt cgacaaactc       420
     gtggaggacc acttggcggt gcagtctctc atcagggcat atcaggtcag gggtcaccac       480
     attgcaaaac ttgatcctct cggaattagt tgtgtaaatt ttgatgatgc tccggtaact       540
     gtttcttcaa acgtggatct tgcagttttc aaggaacgac ttcgaatgct aacagtagga       600
     gggttctatg gcctacacga gtctgacctt gacaaggtct tccacttacc caccaccact       660
     ttcatcgggg gacaggagcc agcacttcct cttcgggaga tcatccgtcg gctggagatg       720
     gcctactgcc agcacattgg tgtggagttc atgttcatta atgatttgga acaatgccag       780
     tggatccgac agaagtttga gacccctgga atcatgcagt tcaccaatga ggagaagcgg       840
     accttgctgg ccaggcttgt acgatccacc aggtttgagg agttcctaca gcgaaagtgg       900
     tcctcggaga agcgttttgg tctggaaggc tgtgaggtgc tgatccctgc cctcaagaca       960
     atcattgata tgtcaagtgc aaatggagtg gactatgtga tcatggggat gccacacaga      1020
     ggacggctga acgtgcttgc aaatgtcatc aggaaggagc tggagcaaat attctgtcag      1080
     tttgactcaa agctggaggc agctgatgag ggttctgggg acatgaagta ccacctgggc      1140
     atgtatcacc gcaggatcaa ccgtgtgacc gacagaaaca tcactttgtc cttggtggct      1200
     aacccttccc atctagaggc tgctgaccct gtcgtgatgg gaaagaccaa agctgaacag      1260
     ttctactgtg gagacactga agggaaaaag gtgatgtcta tcctgctgca tggggatgct      1320
     gcttttgctg gccagggcat cgtatatgag accttccatc tcagcgactt gccgtcctac      1380
     acaacccatg gcactgttca tgtggttgtc aacaaccaga ttggcttcac cacagaccct      1440
     cggatggccc gctcctctcc ctaccccact gatgtggccc gagtggtgaa tgcccccatt      1500
     ttccatgtca actcagatga ccctgaagct gtcatgtatg tatgcaaggt ggcagctgag      1560
     tggagaaaca ccttccacaa ggatgttgta gttgatctgg tgtgttatcg acgaaatggc      1620
     cacaatgaga tggacgaacc tatgtttaca cagccactca tgtacaagca gatccgcaag      1680
     cagaagcctg tactgcagaa gtatgcagaa ttgctagtct cccagggtgt cgtcaatgag      1740
     cctgagtacg aggaggaaat ctccaagtat gataagatct gtgaggaagc atttaccaga      1800
     tccaaagatg agaagatctt gcacatcaag cactggctgg attccccctg gcctggcttt      1860
     ttcaccctgg atggacagcc caggagcatg acctgcccct ccactggcct ggaggaggat      1920
     gtcttgttcc acattggaaa ggtggccagc tctgtacctg tggagaactt tactatccat      1980
     ggagggctga gccggatctt gaagacccgc agagagcttg tgacgaaccg gactgtggac      2040
     tgggccctgg cagagtacat ggcatttggc tcactgctga aggaaggcat ccatgtgcgg      2100
     ctgagtggcc aggatgtgga gcggggcacc ttcagccatc gccaccatgt gctccatgat      2160
     cagaatgttg acaaaagaac ctgcatcccc atgaaccacc tttggccaaa tcaggcccct      2220
     tacactgtat gcaacagctc gctgtctgag tacggtgtcc tgggctttga gctgggcttt      2280
     gccatggcta gccctaatgc tctggttctc tgggaggccc agtttggtga cttcaacaac      2340
     atggcacagt gcatcattga ccagttcatc tgcccaggac aggcaaagtg ggtgcggcag      2400
     aatggcattg tgctcctgct gcctcatggc atggaaggca tgggtcccga gcattcctct      2460
     gcccgcccag agcggtttct gcagatgtgc aatgatgacc cagatgtcct gcctgacctg      2520
     caggaagaaa actttgacat caatcagctc tatgactgca actggattgt tgtcaactgt      2580
     tccacccctg gcaacttctt ccatgtgctg cgacgacaga tcttgctgcc cttccggaag      2640
     ccgttaatcg tcttcactcc caaatccctc ctgcgccacc ctgaggcaag aactagcttt      2700
     gacgagatgc tgccaggaac gcacttccag cgtgtgatcc cagaaaatgg acctgcagct      2760
     caggacccac acaaagtcaa gagacttctc ttctgcactg ggaaggtgta ctatgacctc      2820
     acccgagagc gcaaagccag gaacatggag gaggaggtgg ctattacaag gattgagcag      2880
     ctatcaccat tcccctttga cctcctgctg aaagaggcac agaagtatcc caatgctgag      2940
     ctggcctggt gccaggaaga gcacaagaac caaggctact atgactatgt caagccaaga      3000
     cttcgtacca ccattgaccg tgctaagcct gtctggtatg ctggccgaga cccggcagct      3060
     gctccagcca ctggcaacaa gaaaacacac ctgacagagc tgcagcgctt tctggacaca      3120
     gcctttgacc tggacgcatt caagaaattc tcttagatgc tcctggagtt gatgaggcca      3180
     tggcccccat gtccatgacg ctctttgctt ctcaactaaa gaatagtgcc tcagcactgt      3240
     ccacacgtcc cttcgctgtg ccacaccacc cctgttctca taggaattaa gttgtccact      3300
     gcagtgctca gctgctcccc ggtcacatgc tgcccagcct gtgccgactt ctctcaggct      3360
     gcacaccgtt catggagacc ggaaggagca gaataaggaa agggcccctc tcaggacatc      3420
     ctagagaagg aaggcagctc tggccccacc catgccccca gtgcaatcct ccagggtagg      3480
     aacagaaccc tatgtggctt cccagggtac tagcactcag ccctcgtcac ccatcaagtc      3540
     gcagattcaa ggccaggagt agtttcatct tgctagggcc aagctgagag ctcatggagg      3600
     aactatagct gccaggattt gggagtcatc aggatgttgt gtgaatagag attgtcatgg      3660
     ggtatttaga ggactttagc agtgatgtta gtctagccct gctacccttc ttgggtttgg      3720
     gctgtatgtg ggaaacttac cccagctacc acgcctggag agcttggctc tgagtacggc      3780
     ccagaagctc cattggctcc caacgccagg cactgctgcc tcttggtcct gctgcctctg      3840
     ctctcctgac ccctccccag tcacttcatt ttctctgttg ttcccttgaa cacacagaag      3900
     ctgttgacga attctttttt ttgctgtgcc aaggcaggtc aaaagcagat cagtggataa      3960
     gagcaagttg tcccaaggag ccagctgtcc ttcctccctc ttttgacctc cactgggaca      4020
     cacctgattt atttattttg gttaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa       4079
//


spacer
spacer