Dbfetch

ID   BC057337; SV 1; linear; mRNA; STD; MUS; 4639 BP.
XX
AC   BC057337;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus myotubularin related protein 1, mRNA (cDNA clone MGC:66969
DE   IMAGE:6825916), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4639
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4639
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b8071d6d30b76e51627ca04c49bb2080.
DR   Ensembl-Gn; ENSMUSG00000015214; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035782; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035765; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035687; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035752; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035455; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036282; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034747; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035430; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035583; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035534; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035672; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035569; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036303; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034447; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034889; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000015358; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096290; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0096379; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0096320; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096303; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095854; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096812; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096448; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095774; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095978; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095824; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0096012; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095787; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097156; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095865; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094833; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 126 Row: k Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 8393793.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4639
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FY0"
FT                   /clone="MGC:66969 IMAGE:6825916"
FT                   /tissue_type="Brain, mouse, 13.5,14.5,16.5,17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4639
FT                   /gene="Mtmr1"
FT   CDS             150..2159
FT                   /codon_start=1
FT                   /gene="Mtmr1"
FT                   /product="myotubularin related protein 1"
FT                   /db_xref="GOA:Q9Z2C4"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="InterPro:IPR030587"
FT                   /db_xref="MGI:MGI:1858271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2C4"
FT                   /protein_id="AAH57337.1"
FT                   /translation="MDRPVAAAAAASAASCEGAGGPGPGPGASWRPSRVAGGASASSRH
FT                   PSIETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPL
FT                   FPGESIKAIVKDVIYICPFMGAVSGTLTVTDFKMYFKNVERDPHFVLDVPLGVISRVEK
FT                   IGAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQRKLGIFENLNKHAFPLSNGQVLFAFNY
FT                   KEKFPVNGWKVYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLS
FT                   KVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHK
FT                   LTIFDARQNSVADTNKAKGGGYENESAYPNAELIFLEIHNIHVMRESLRKLKEIVYPSI
FT                   DESHWLSNVDGTHWLEYIRVLLAGAVRIADKIESGKTSVVIHCSDGWDRTSQLTSLAML
FT                   MLDSYYRTIKGFEALIEKEWISFGHRFALRVGHGDDNHADADRSPIFLQFIDCVWQMTR
FT                   QFPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQRIKEDVYTNTISLWSYINSQLDEF
FT                   SNPFFVNYENHVLYPVASMSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAIKAELQKR
FT                   VEDLQREMATRTISSSSERGSSPTHSATPVHTSV"
FT   misc_difference 4374
FT                   /gene="Mtmr1"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 4622..4639
FT                   /gene="Mtmr1"
FT                   /note="polyA tail: 18 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4639 BP; 1281 A; 985 C; 1041 G; 1332 T; 0 other;
     cgcggggccg ccaggtgaca gctaatggcg gcggccgctt gacgcgagcg gtcaagcagc        60
     gaagcagggc ggcagggggc gcgtcgggga gcctggctgc cgctgcactc cggactgtgg       120
     ctcaccggag gcgccgggct tgacgcgtca tggacaggcc agtggcggcg gcggccgccg       180
     catctgcggc gagctgcgag ggcgctgggg gcccggggcc agggccgggc gctagctgga       240
     gaccctctcg ggttgcgggg ggcgcctcgg ccagctcccg gcaccccagc attgagaccc       300
     ttgacagtcc tacagggtca catgttgaat ggtgtaaaca gcttatagct gctacaattt       360
     ctagtcagat ttcaggttca gtgacatcag aaaatgtgtc aagagattac aaggctctaa       420
     gggatggaaa taaactggca cagatggaag aagctccact tttcccagga gaatcaatta       480
     aggccattgt gaaagacgtc atttatatct gtccatttat gggagcagtg agtgggaccc       540
     tgacagtgac ggactttaaa atgtacttca aaaatgtaga aagggaccca catttcgtcc       600
     ttgatgttcc tcttggagtg atcagcagag tggagaagat tggtgcacag agccatgggg       660
     ataattcttg tggtatagag attgtgtgca aggatatgag gaacctgaga cttgcatata       720
     agcaggaaga acagcgaaaa cttgggatat ttgaaaacct caacaagcat gcttttcctc       780
     tttccaatgg gcaggtgcta tttgcattca actataaaga aaagtttcca gttaatggct       840
     ggaaagttta tgatccagtg tctgaatata agagacaggg cttgccaaat gagagttgga       900
     aaatatcaaa aataaacagt aattatgagt tctgtgatac ctatcctgcc atcattgttg       960
     tgccaactag tgtgaaagat gatgaccttt caaaagtggc agcctttcga gcgaaaggca      1020
     gagtccctgt gttgtcatgg attcacccag aaagtcaggc aacaattaca cgttgcagcc      1080
     agccattagt gggtcccaat gataaacgct gcaaagaaga tgagaaatac ctgcagacaa      1140
     taatggatgc taatgcacag tcacataaac ttactatctt tgatgccaga caaaacagcg      1200
     ttgctgatac caacaaggca aagggtggtg gatatgaaaa tgaaagtgct taccctaatg      1260
     ccgaactcat attcttggag atccacaata ttcatgtgat gagggagtca cttcgtaaat      1320
     taaaggagat tgtgtatcct tcaattgatg agtcacattg gctatccaat gtggatggga      1380
     cacattggct ggaatatata cgggttctcc ttgctggggc agtgagaatt gctgataaaa      1440
     tagaatctgg gaaaacttcc gtggtcatcc actgcagtga tgggtgggat cgaacatccc      1500
     agctcacatc tctggcaatg ctgatgttag acagttatta ccggaccatt aaaggatttg      1560
     aggctctcat agaaaaggag tggataagct ttggacacag gtttgccctg agagtgggcc      1620
     atggtgatga caaccatgca gatgctgacc gatcacctat atttcttcag tttattgatt      1680
     gtgtttggca gatgacaaga cagttccctt cagcatttga gtttaatgaa ttattcttga      1740
     ttacaatttt ggatcacctc tatagttgtc tttttgggac ctttttgtgc aactgtgaac      1800
     aacagcgaat caaagaggat gtatatacaa atactatatc tttatggtct tatatcaata      1860
     gccaactaga tgaattctca aatcccttct ttgtgaatta tgagaaccat gtgttatatc      1920
     ctgttgctag tatgagtcac ttggaattgt gggtaaatta ttatgtacgg tggaatccac      1980
     ggatgagacc acagatgcca attcatcaga atctcaagga actgctggct atcaaggctg      2040
     agctgcagaa gcgtgtggag gacttgcagc gggagatggc cacccggacc atctcatctt      2100
     cctctgagag gggctcctca cctacccact cagctactcc tgtacacacc tcagtctgat      2160
     gaacaaagcc agtaccccgg gccatccggc tgctctattg tcttccagca gctcggggac      2220
     ctggccattg atattatggt tctagcttgt catcttagct cttaggactc agcccaggga      2280
     ccatttgtgg gtggtgaaag ctcctattat taacaagtac ttcttttgtg tgaacagcct      2340
     gtgccccttt tgcgagcagc ctcaccctgt gaaccacctg tgtcttgtac aggtagcttg      2400
     ggagaaacca gattgaatgc agtgcggtat tttaacttaa gagaatctta caccacttct      2460
     ttccaagtta catcctttgt tacgaacaac tcgtttactt atagaacaca tcaccagcca      2520
     tgtggctcct ctcagccttt tggcacaatt taaaaactgt tttaaatgaa atgttagtgt      2580
     ggcaaatgaa ccattgccac ctgttctaca gttatcagtt atcttcatac aagaagtcct      2640
     gttcaactgg tacaatatgt actgctgtgt acatataagg tattttttaa agagaaacat      2700
     gcctttattt tcctatgtcc ttttttatgt ttagaatagc ctgagaaatc atctgctaaa      2760
     ctgtgctgta ggagaaattc tttcccaacg gagtccatgc tgccttttgc gcagcacatt      2820
     tgaattaaga ttcgagatgt gtcagctcag tggcaatgga gtgttgtcct ctaactctgg      2880
     tacttgtctt ttgagatggc acagcccatt cattcattgg tggtagcagc aggttccctc      2940
     aggatgcagc aaactatgaa tgctcagtcc tctggccttg tcgcaggtaa actgagggct      3000
     caggcagcaa ctctgcattt gttggcctcc ctctatgaca gctctctaaa ggagcaagtc      3060
     ttgaaaattg ctttggcatc ctaccacctg ttaagatgcc cagcatctat gtcaaatcaa      3120
     gtcgtctctc acctgttaga cacctggaca gcttgctttc atttaccacg atctcttctc      3180
     agttgattta catgactgcc tggccatact ttaaggcaac cagtggctaa aatactcatg      3240
     aaattaaata tcagtgattg cactgaactg tatacttcag atgagctaat tttactacgt      3300
     taatttagca tttatttaag tggagaatta attagttttg tattccctat tttacaaaaa      3360
     ttgataaaga tatagttcat ggattttatt ctgctgttat gggtttattt ctatgggtct      3420
     gaaagcataa catgctcttc catggttttc ccctctcgga cccagccctg gcttggcagg      3480
     cctctttcca cagttaacag tgttgatctc tgctactcaa ccagtccttc taggaatgaa      3540
     tctcccatca gcttcgacgt gtgcaatgcc agcatagcca ccaccaccac catgtccact      3600
     tctgtgtgtc accaggccct tcagagttgg agatgtgttt gaggctgacc aagtgagccc      3660
     ctgaggacag atggctcaca tcttcctctt gtcagtgtca aatcactgga tgctgtgcag      3720
     tcctacacat taacctcggt tttcaaaagt gttcttaaaa gaatttttac agccaaatac      3780
     atagaaacta gatgattttt caacttacag aaaactaccc aactataaga taaccagaga      3840
     catttattca aggaagtttc ataagttatg atcaattctc catttttaat catctggggg      3900
     atttgtttct aaactacagt ttaagtgatt ttagcttttg atttgtgttc atcatagata      3960
     taaaacctta tttgtagatg gataaactgc catatctgag gtaggagaag ctgtgagttc      4020
     agggacagct ttggctacat atcgagttct gggacagctg gcctatattg tggagccctg      4080
     tctcaaaatc aataccaaaa agaaaataac atgaactata atattttttt tcttcatata      4140
     ctttttaaaa gtggggacat ttaccaattt ttccctagaa atactgtgta atttcccagc      4200
     gacacttgaa ctattgaaga tagagtggac tggataatgt tttgacagaa ccagagaagc      4260
     catggggatg gctgcttgtt gaggtcagct agcctggtac agatggctgg taaactgtgg      4320
     ctctggctcc tgctcaagcc atggcctccc agctgccatg cctgcagcac cccaaaaaat      4380
     gtccactgga ttttaaagaa gcacaacaga gtctttccct ttgtatgttt ctagcacaga      4440
     actgtttcta aaacaacttg aagtatagtt ttcttatcta aacaattctt tcatgtatgt      4500
     tttatttaag tactataatg taaacccttt aaggttcagg tttttaaaca agtacaatac      4560
     tgtatttgcc tcatctgaag cactgtattc caacatgtaa ctaaaatgat aatatgtttg      4620
     caaaaaaaaa aaaaaaaaa                                                   4639
//