Dbfetch

ID   BC057123; SV 1; linear; mRNA; STD; MUS; 2032 BP.
XX
AC   BC057123;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus vesicle-associated membrane protein, associated protein B and
DE   C, mRNA (cDNA clone MGC:61329 IMAGE:6411688), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2032
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2032
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (28-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 42b1c9f4099ac70812350a015ca976cc.
DR   Ensembl-Gn; ENSMUSG00000054455; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026961; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026928; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026899; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026937; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026679; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027384; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026138; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026656; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026794; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026760; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026895; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026779; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027441; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025874; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026210; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000067530; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059580; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059613; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059554; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059544; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059235; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060013; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059521; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059209; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059317; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059294; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059423; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059281; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060197; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059094; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058514; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328447.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2032
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FP0"
FT                   /clone="MGC:61329 IMAGE:6411688"
FT                   /tissue_type="Brain, enriched mouse brain 15dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2032
FT                   /gene="Vapb"
FT                   /note="synonyms: Vamp33b, VAP33b"
FT   CDS             112..843
FT                   /codon_start=1
FT                   /gene="Vapb"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein B and C"
FT                   /db_xref="GOA:Q8BH80"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="InterPro:IPR030226"
FT                   /db_xref="MGI:MGI:1928744"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BH80"
FT                   /protein_id="AAH57123.1"
FT                   /translation="MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVK
FT                   TTAPRRYCVRPNSGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEA
FT                   VWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKIIPTSASKTEAPAAAKSLTSPLDD
FT                   TEVKKVMEECRRLQGEVQRLREESRQLKEEDGLRVRKAMPSNSPVAALAATGKEEGLSA
FT                   RLLALVVLFFIVGVIIGKIAL"
FT   misc_difference 1692
FT                   /gene="Vapb"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 1975..2032
FT                   /gene="Vapb"
FT                   /note="polyA tail: 58 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2032 BP; 542 A; 485 C; 567 G; 438 T; 0 other;
     gtcgtgcgtg ccgtgagctc gcccggcacc gcggcctcgc cctccgcccc tgcgccccgc        60
     cacccaggcc gccgcccccc gcccgcgccg tcgcccccga cggggaggac catggcgaag       120
     gtggaacagg tcctgagcct cgagccacaa cacgagctca agttccgagg tcccttcact       180
     gatgttgtca ccaccaacct aaagcttggc aacccaacag accgaaatgt gtgttttaaa       240
     gtgaagacca cagcacctcg caggtactgc gtgcggccca acagtggggt cattgatgcc       300
     ggggcctctc tcaatgtgtc tgtgatgtta cagcctttcg attatgatcc caatgagaaa       360
     agtaaacaca agtttatggt tcagtctatg tttgctccgc ctgacacttc tgatatggag       420
     gcagtatgga aggaggcaaa accggaagac cttatggatt caaaacttag atgtgtgttt       480
     gaattgccag cagaaaatgc taaaccacat gatgtagaaa taaataaaat catacctacg       540
     agtgcatcca agacagaagc accggcagcc gcaaagtccc tgacatcgcc cctcgatgac       600
     acagaagtaa agaaggtgat ggaagagtgc aggcggctgc agggggaggt gcagaggctt       660
     cgggaggaga gcaggcagct caaggaagaa gacggacttc gggtgaggaa ggcgatgccg       720
     agcaacagcc ccgtggcggc tctggcggcc actgggaagg aggagggcct gagcgcccgg       780
     ctgctggccc tggtggttct gttctttatc gttggtgtca ttatagggaa gattgccttg       840
     taggggccgc atgcgaagga tggcaggttg gattgatgga tctaccacac catgggattc       900
     aaatttatca taaccatgcg taaaaagaaa ttaatgtatg acggcatctc acaggtcttg       960
     cctttaaata cccctcccca tgcacacaca aatgcacaca caaatatagc ataatataat      1020
     gatcttttag aaagttaaaa atgtataggg aatggatggg gaaagaatgg tctgttgccg      1080
     taggacgggc cgtgattaac cacagtggca tcttgtagct gtcacgctca attcgggtag      1140
     gcctgggcac gtgttgctag atcactctct taaagcaaga agctcctcct cgcatgttgg      1200
     ggctggcccg tgggagcggg agtcctgcaa ggtggggcga gctgtctttt tcttacccac      1260
     gtggcttccc caggcctgct gttctgtcca ggcatcgtct cctcaggcct acagagctgc      1320
     aggtgccaaa gtgcattgca cagaggccac atctcgtgta cctgtgggtc gtgtgggaga      1380
     gacatgagtg gaccagcggg tccaacacag ggaaatccaa gtctgtgctc tgttctcttg      1440
     aagggaccaa gctaaattac cgctggttca agtagtgaac cgagttgttc tcggagatgg      1500
     ctgatgcaca tgtaacctat ttcatctcgt gtgttcctgc tgccaccaga gcacaggcag      1560
     tgagtgctgc agaccgccag tgaggagctg ctgctgtggg ctctggaggt ctgagggaag      1620
     gggagggtct gagtcaggaa gtgttttgtt gtaggtcagt aatagctgcc ctgaggagga      1680
     acgctctttt ttaatgacag tcagctctgg attacccagt cttctagatt gccctaccat      1740
     ccatccttct aaaacatagg ccagccttga cctgcccttc tcaggatgag tgagtcaggc      1800
     tgcagagggt gaagggcata gagggggtgg ggtggggtgg gggagccctc agcaaatcca      1860
     tctgctggtg atgaagagtc ctgactgtga attaatttca tgccataaaa gaccgatcca      1920
     gttctgctca actatgtagc atcttaaagg aagagattaa aataaagccc caaaaaaaaa      1980
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa              2032
//