spacer

EBI Dbfetch

ID   BC057005; SV 1; linear; mRNA; STD; MUS; 4611 BP.
XX
AC   BC057005;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus sprouty homolog 4 (Drosophila), mRNA (cDNA clone MGC:67021
DE   IMAGE:6821944), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4611
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4611
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ee7910438e82f6e90d9c630d2a7a94aa.
DR   Ensembl-Gn; ENSMUSG00000024427; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025295; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 126 Row: h Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543766.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4611
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FY0"
FT                   /clone="MGC:67021 IMAGE:6821944"
FT                   /tissue_type="Brain, mouse, 13.5,14.5,16.5,17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4611
FT                   /gene="Spry4"
FT                   /note="synonym: sprouty4"
FT   CDS             147..1049
FT                   /codon_start=1
FT                   /gene="Spry4"
FT                   /product="sprouty homolog 4 (Drosophila)"
FT                   /db_xref="GOA:Q9WTP2"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="MGI:MGI:1345144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTP2"
FT                   /protein_id="AAH57005.1"
FT                   /translation="MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMK
FT                   TSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSS
FT                   STSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEAC
FT                   GKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCAD
FT                   HPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS
FT                   VICKAASGDTKTSRSDKPF"
FT   misc_difference 4591..4611
FT                   /gene="Spry4"
FT                   /note="polyA tail: 21 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4611 BP; 1064 A; 1209 C; 1123 G; 1215 T; 0 other;
     ctccgactga cgtctgcgac ttcaacggcg actgacccac tcgggttcgg ggatttacac        60
     agacgtggag cgatgcttgt gactctgcag ctcctcaaag acccctagaa gcctgtccct       120
     tggtgcagtt caggacctcc agcctcatgg agcccccggt tccacagagc agcgtccctg       180
     tgaatcccag ctcagtcatg gtgcagcccc tccttgacag cagagcgccc cacagccggc       240
     tccagcaccc actcaccatc ttacccattg accagatgaa gaccagccac gtggagaatg       300
     actacataga caaccctagc ctggcccctg ccacgggtcc caagcggccc cggggcgggc       360
     caccagagct ggctcctaca cctgcccgct gtgaccagga tattactcac cactggatct       420
     ccttcagcgg tcggcccagc tctgtaagca gcagtagcag cacttcctcc gaccagaggc       480
     tcctagatca catggctcca ccgcccgtgg ctgagcaggc ctcacccagg gctgtgcgcc       540
     tccagcccaa ggtggttcac tgtaagccgc tggacctcaa aggcccgaca gctccgccag       600
     agctagacaa gcacttcttg ctgtgtgagg cctgtggaaa gtgtaagtgc aaagagtgtg       660
     cgtcccctcg gacgttacct tcctgctggg tctgcaacca ggagtgcctg tgctcggctc       720
     agacgctggt caactatggc acatgcatgt gtctggtgca aggtatcttc tatcactgta       780
     ctaatgagga tgatgagggc tcttgcgccg accacccctg ctcctgttcc ggctccaact       840
     gctgcgcccg ctggtccttc atgggcgccc tctctgtggt gctgccctgt ctgctgtgct       900
     acctgccggc cacaggctgc gtcaagctgg cccagcgagg ctacgaccgc ctgagacgcc       960
     ccggttgccg ctgcaagcac acgaacagcg tcatctgcaa ggcagccagt ggggacacca      1020
     agaccagcag gtctgacaag cctttctgac actttggatg aaaaaaacat ggtccctcct      1080
     gccagtctcc tgagactgac cttgctcatc tgtcctctcc taaaacccta gattgggaag      1140
     aaaccggcag agaacactac tgcctagcct tgagtcccca aaaggatgaa gatgtacttt      1200
     ggggattttc acagtcttga aactttgtta aacagcagtg acagtgttag ggtatggtgg      1260
     tagggggccc agttttccta tttcagaaga cggaagacag atgcggacac agggtctgca      1320
     agttcagcca ctcaatggcc ttcccagccc ctctgcttcc tctcattttg ccattctctc      1380
     tggctcctgc tggagccttc tacctgggag gaacagctaa tgggaggcaa gatacctcga      1440
     ggaagaccct ccgagccttg acttctatct ttgccgcctc cgtccatgcc tgttggcctt      1500
     ggcctcttgg gaaggtgcac cgtagccatt cctgctgtat gcacttgatg tccgagaaca      1560
     aaatcgccgg taagctgctg cctcccgtga gtagcaggat ggagaaggaa ccacctggca      1620
     gtgtgttcct cctagctttc aatcactaac ttgggggttg tccgctcatc acgccatcct      1680
     ccagttcaca gactggcctg cctgctatgc gtcctgagca ctctttctac tcggattctt      1740
     tgtagaaact cgctgggtta agaaggccag gatgacacaa gcaagaccaa atatcatttt      1800
     gccaatgagt ctgaggctgt ggtctctgga tccagccatg atgtttttat atgtttaatt      1860
     aaactagatg ctattggtgt ttaaacaata ataatacaac aaccttgctt ccttttgggc      1920
     cacccccagg aagggctgat ttcaaaatct gggggtaagc aacctcaagg agcgtttccc      1980
     ctgcacatcg agaatggcaa agaagaggcc gtacctccca ttggcaggat gacagttgag      2040
     ccgaactggg gttgggtttt cttgtgattc tgctgcttgc tgtctctagc cttttgtgta      2100
     tagtgatgcg tctgtcttta tgtaaataga gatgacagag tctattttag tgttaagaag      2160
     ccctggtggg gaagtcggaa gatgccagag aaggtgggga acgatcctcc aggggctgct      2220
     gggtttgagc cccacttttt gtgtgcacac acacagacac ccctcccaac agcccccaaa      2280
     gacgtagcaa ctctttctct cacggtgcta aaggactcag aacgcgcagc ccgtccagtg      2340
     ggtaggtact tgttgcatgc aaaaagctat cgtgtctctg gtccttgccc ccagctgttg      2400
     tgtgggtggg ttttttttgt tttttttgtt tttttttttg ttgttgtttt tggttttggt      2460
     tttttctttg tgtggtattt tgtccccatc cctgcctctg attcaagaaa tagcctgggt      2520
     cagaagaggt accccaggta aaattgagag agcattaggc aaaaatcatg tggagcattt      2580
     ctggttcttt tgtgtgagca gcccctaggg aggaggcaag gagtcaggta gctgtaagtg      2640
     gagtgtacct attgctcttt tctcaaggat tcacccccac ccccaccttg gaagctacta      2700
     gtagtaatag taacacctta tgatttagaa taagttaatt gtaaccatag gtatttattg      2760
     attggaggaa gggagggttt tattttcagc tttatttatg caacatttac tggcttgtaa      2820
     aaggcaagta taaaatcctg catcttcatc gtctataact aatccataca tatacctgcc      2880
     cttgccacat tgcagtgttc ttgcacagaa cggaaggaaa gatagaagac aaacccctgc      2940
     gatcagcaaa ccacttacac taattgaatg tattagaagc tttctgaagg ggctggagat      3000
     gttttcctcg aatgaggggt gtggagggac ccccccccca aaaaaaaacc ctgatagcgc      3060
     acacgtgcac tctttctaag aagcctggga gcttcaccca gggtccctcc ctcaatttgt      3120
     atccacagga cagctgaccc agtggcaggt tgcactttgg tgatcttggt ctgcatacgt      3180
     ctgtggacag ttgagctata taagccgtgt atgcgcacat gcacacgtga cacttacata      3240
     cacagaccct ctaccacaca gaccctgttt cctggcaacc cttcccaaac cctgactttg      3300
     tgtacatagc tgtaaacacg gatttggggg gttttggttt gcttccccac ctcaccaacc      3360
     ccttgttctg gtttggaaat gatgtctaca gaattcttcc tccccacaga agttgacctt      3420
     gggactcact tgctcagtgg taagggaagg ggagaaggaa ggaaggaagc atcctttttc      3480
     ctctgctctg ttgttttttc tctgacttct tggcaaacac acatagggga tgcaaacaca      3540
     gaaaaggggt agtttgttta tagggccccc tccccttccc aggttagtca acaggcattg      3600
     ggaacacagg ctctcacaaa cagaacattt ctgtagctgt ttctgacttc ttggctagca      3660
     tttgcagctt ttgcttggct tgagttaaca tcacttccaa agtgccagct ggttcccact      3720
     tctagacctg gggtggctgt cagttgtgcc tggagccaag gatggcttcc gggatctttc      3780
     ttaaggtgcc tgggctactt ggtaccattg tagggaaagg ctggttctcc tgtaagcact      3840
     ctgggggctg agtttaggct agcaacatct tccaaggtac catcaatgct cctcaagcca      3900
     actggaagag agcaacgagc ggcctttctc agcgatggga ggcatcctta cgactgatag      3960
     gttctttgag ctagtgtagt tctgcatcaa tggggcccag ctggatcaca gcctcaaggg      4020
     aacaacacat accaagttgg tcaggggcag aaccaggcag gtacccatca ttctagagca      4080
     gcttggtctc cagtgctgct ccaagaaata gtggaggcgt gtgggcagca cacatttgca      4140
     ctgtacaatt gaacatccgg ggcttccccg gcttcccaat ttatgcattt ggtgagtagc      4200
     tccgtgccct tccccgctct gtaatggtgg atgtcgatcc tgtgtttcca ttttgattgt      4260
     gggtgactgt gctgtttctt agcttgcttt tctcttgtgt cctgtggttg atttcctgtt      4320
     agcagcacta gagctgtgcc cagcacccca ctccaccaca ttcctgtgtc tctgtagctc      4380
     cccctccccg cccctgttca tcccaccaca aaagttacca cagaaggttt cctttgtaaa      4440
     aaatatttat tttgaagctc tattttaata gtatttattt tagaaagtct actattgtaa      4500
     gagttcttct gtttgtgaag aaaaaaaaac aagttaaaaa ctgaatgtac tgatctagaa      4560
     gatatctata aatatatatt gttaaatata aaaaaaaaaa aaaaaaaaaa a               4611
//


spacer
spacer