spacer

EBI Dbfetch

ID   BC056926; SV 1; linear; mRNA; STD; MUS; 5155 BP.
XX
AC   BC056926;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus brain-specific angiogenesis inhibitor 2, mRNA (cDNA clone
DE   MGC:66520 IMAGE:5705854), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5155
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-5155
RA   Strausberg R.;
RT   ;
RL   Submitted (25-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; fd73cce9a05d4b02aa0dcf0d889f7171.
DR   Ensembl-Gn; ENSMUSG00000028782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106015; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106017; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121049; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
CC   Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
CC   Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
CC   Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
CC   Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
CC   Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
CC   Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
CC   George Yang, Scott Zuyderduyn, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 124 Row: j Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 27414502.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5155
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EX0"
FT                   /clone="MGC:66520 IMAGE:5705854"
FT                   /tissue_type="Brain, mouse 15.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..5155
FT                   /gene="Bai2"
FT   CDS             160..4809
FT                   /codon_start=1
FT                   /product="Bai2 protein"
FT                   /db_xref="GOA:Q8CGM1"
FT                   /db_xref="InterPro:IPR000203"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR008077"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR022624"
FT                   /db_xref="MGI:MGI:2451244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGM1"
FT                   /protein_id="AAH56926.1"
FT                   /translation="MTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDL
FT                   FPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCTHFAPRLLPLDHYLVNFTCLRPGPEE
FT                   ATARAESEVGRPEEEEEEAAAAASGLELCGGSGPFTFLHFDKNFVQLCLSAEPSEAPRL
FT                   LAPAALAFRFVEVLLINNNNSSQFTCGVLCRWSEECGRAAGRACGFAQPGCSCPGEAGA
FT                   NPATTTSPGPPVAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYGEEPEEEPKVK
FT                   TQWPRSADEPGLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPL
FT                   RETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQT
FT                   KLCSMAACPVEGQWLEWGPWGPCSSSCANGTQQRSRKCSVAGPAWATCAGALTDTRECS
FT                   NLDCPATDGKWGPWNAWSLCSKTCDTGWQRRFRMCQASGTQGYPCEGTGEEVKPCSEKR
FT                   CPAFHEMCRDEYVMLMTWKRAAAGEIIYNKCPPNASGSASRRCLLSAQGVAYWGLPSFA
FT                   RCISHEYRYLYLSLREHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFSVDILR
FT                   NVTDTFKRATYVPSADDVQRFFQVVSFMVDSENKDKWDDAQQVSPGSVHLLRVVEDFIH
FT                   LVGDALKAFQSSLIVTDNLVISIQREPISAVSSDITFPMRGRRGMKDWVRHSEDRLFLP
FT                   KEVLSLSSPGKPATPGAATAGSPGRGRGPGTVPPGPGHAHQRLLPADPEESSSYFVIGA
FT                   VLYRTLGLILPPPRPPLAVTSRVMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASW
FT                   DYSRADTNSGDWNTESCQTLETQAAHTRCQCQHLSTFAVLAQPPKDLTLELAGAPSVPL
FT                   VIGCAVSCMALLTLLAIYAAFWRFIKSERSIILLNFCLSILASNILILVGQSRVLSKGV
FT                   CTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPALVVAVSV
FT                   GFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGVSDKSK
FT                   KQRAGRLSWNLWGYGSQLCLFPKLPRASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQ
FT                   ALFAVFNSAQGFVITAVHCFLRREVQDVVKCQMGVCRADESEDSPDSCKNGQLQILSDF
FT                   EKDVDLACQTVLFKEVNTCNPSTITGTLSRLSLDEDEEPKSCLVGPEGGLSFSPLPGNI
FT                   LVPMAASPGLGEPPPPQETNPVYMCGEGGLRQLDLTWIRQSEPGSEGDYMVLPRRTLSL
FT                   QPGGGGTAGEEAPRARPEGTPRRAAKTVAHTEGYPSFLSVEHSGLGLGPAYGSLQNPYG
FT                   MTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKLGSLERKKLRYSDLDFEKVMHTRK
FT                   RHSELYHELNQKFHTFDRYRSQSSAKEKPSPPGGRPGLSQHRRHQSWSTFKSMTLGSLP
FT                   PKPRERLALHRTAAWEPTEPPDGDFQTEV"
FT   misc_feature    1072..1218
FT                   /note="TSP1; Region: Thrombospondin type 1 repeats"
FT   misc_feature    1396..1548
FT                   /note="TSP1; Region: Thrombospondin type 1 repeats"
FT   misc_feature    1564..1716
FT                   /note="TSP1; Region: Thrombospondin type 1 repeats"
FT   misc_feature    1723..1908
FT                   /note="HRM; Region: Hormone receptor domain. This
FT                   extracellular domain contains four conserved cysteines that
FT                   probably for disulphide bridges. The domain is found in a
FT                   variety of hormone receptors. It may be a ligand binding
FT                   domain"
FT   misc_feature    2749..2910
FT                   /note="GPS; Region: Latrophilin/CL-1-like GPS domain.
FT                   Domain present in latrophilin/CL-1, sea urchin REJ and
FT                   polycystin"
FT   misc_feature    2926..3732
FT                   /note="7tm_2; Region: 7 transmembrane receptor (Secretin
FT                   family)"
XX
SQ   Sequence 5155 BP; 968 A; 1642 C; 1529 G; 1016 T; 0 other;
     gcggagcggg agcctcgggc ctcggcgcgg ctgcggcgag ctgccctgcg cccagcccgg        60
     cccccgcctt agggatggca aacttgcgcc ccgcggccgc ctccactagc gccggccccc       120
     gctcctgctg ctgacggcgc ccagggcaag ggacatagga tgaccccagc ctgtcccctc       180
     ttactgtctg tgattctgtc cctgcgcctg gccacggcct tcgaccctgc ccccagtgcc       240
     tgctctgccc tggcctcggg cgtgctctac ggggccttct cgctgcagga cctctttccc       300
     accatcgcct cgggctgctc ctggaccctg gagaacccag accccaccaa gtactccctc       360
     tacctgcgct tcaaccggca ggagcaggtt tgcacacact ttgccccgcg cctgctgccc       420
     ctggaccact acctggtcaa ctttacctgc ctgcggcctg gtccagagga agccacagcc       480
     cgggctgagt cggaggtggg acggccagag gaggaggagg aggaggcggc ggcagcagca       540
     tcagggttgg agttgtgtgg tggctcaggc ccctttacct ttctgcactt cgacaagaac       600
     tttgtgcagc tgtgcctgtc ggctgagccc tctgaggccc ctcgtctgct agcgcctgct       660
     gccctggcct tccgttttgt ggaggtcttg ctgatcaaca acaacaactc cagccagttc       720
     acctgtggtg tgctctgccg ctggagtgag gagtgtggcc gggctgcagg cagggcttgt       780
     ggctttgcac agccagggtg tagttgtcct ggggaggcag gggccaaccc cgccaccacc       840
     acatctccgg ggcctccggt tgcccacacc ctgtccaatg ccctggtgcc cgggggccca       900
     gcccctcctg ctgaggccga cttgcactcg gggagcagca atgacctgtt caccaccgag       960
     atgagatatg gtgaggagcc ggaagaggaa ccgaaggtga aaacccagtg gccaaggtct      1020
     gcagatgagc ctgggctata catggcgcag acaggcgacc cagcagctga ggagtggtcc      1080
     ccgtggagcg tgtgttccct gacgtgtggg cagggtctgc aggtgcggac ccgctcctgc      1140
     gtgtcctccc cctatgggac cctgtgcagc gggccccttc gggagacccg gccttgcaac      1200
     aattcagcca cctgcccagt gcacggcgtg tgggaggagt gggggtcctg gagcctgtgc      1260
     tcccgcagct gcgggcgggg gtctcggagc cggatgcgga cctgcgtgcc cccccagcac      1320
     ggcggcaagg cctgcgaggg tcccgagctg cagactaaac tctgcagtat ggccgcctgc      1380
     ccggtggaag gccagtggct agaatggggt ccctggggcc catgctcatc atcttgtgcc      1440
     aatgggaccc agcagcgcag ccggaaatgc agtgtggcgg gtccagcctg ggccacgtgc      1500
     gcaggtgccc tcacggatac ccgtgagtgc agcaatctcg attgcccggc cactgacggc      1560
     aagtgggggc cgtggaacgc gtggagcctg tgctccaaga cgtgtgacac gggctggcaa      1620
     cgccgcttcc gcatgtgcca ggcttctggc acacagggct acccttgcga gggcacagga      1680
     gaggaggtga aaccctgcag tgagaagagg tgtccagcct tccatgagat gtgcagggat      1740
     gagtacgtga tgttgatgac atggaagagg gcggcagctg gcgagatcat ttacaacaag      1800
     tgtcccccta atgcctcggg ttctgctagc cgccgctgtc tcctcagtgc ccagggcgta      1860
     gcatactggg gactgcccag ctttgctcgt tgcatatccc atgaataccg ctacctgtac      1920
     ctgtcacttc gggaacacct ggctaagggc cagcgcatgc tggcaggtga gggcatgtca      1980
     caggtggtgc ggagcctgca ggagctactg gcacggcgca cttactacag cggggacctg      2040
     ctcttctctg tggacatcct aaggaacgtc actgacacct tcaagagggc cacctatgtc      2100
     ccttccgccg atgacgtgca gcgtttcttc caggtggtga gcttcatggt ggattcagaa      2160
     aacaaggaca aatgggatga tgctcagcag gtgtcaccgg gctctgtgca cctgctgcgt      2220
     gttgtggaag atttcattca cctcgtgggc gacgctctca aggccttcca gagctctctc      2280
     attgtcacgg acaatctggt gatcagcatt cagagagagc ctatctccgc cgtgtccagt      2340
     gacatcacgt ttcccatgcg gggccgcagg ggcatgaagg actgggtgcg acactcagag      2400
     gatcgtctct ttctacccaa ggaggtgctc agcctgtcct ccccaggaaa gccagccaca      2460
     cctggggcag ccacagcagg cagcccgggc agggggaggg gcccaggaac ggtgccccct      2520
     ggcccaggcc acgcccacca gcgccttctc ccagctgacc ccgaagagtc ctcctcctac      2580
     tttgtgatcg gtgctgtgct ctaccgcacc cttggcctca tcctgccgcc ccccaggcct      2640
     ccacttgctg tcacctcccg ggtgatgaca gtgactgtgc gtccccccac ccagcctcca      2700
     gctgagcccc tcattacagt ggaactctcg tacatcatca atggcaccac cgatccccac      2760
     tgtgccagct gggactactc cagagcagat accaactcgg gggactggaa cactgagagc      2820
     tgccagacct tggagaccca ggcggctcac acccgctgcc agtgccagca cctgtccacc      2880
     tttgccgtcc tggcccagcc acccaaggac ctgaccctgg agctggcagg tgctccctct      2940
     gtccccctgg tgatcggctg tgcagtgtcc tgcatggctc tgctcaccct gctggccatc      3000
     tatgcagcct tctggaggtt tataaaatca gaacgctcca tcatcttgct gaacttctgc      3060
     ctgtccatcc tggcttccaa cattctgatc ctggtgggcc agtcccgggt gctgagcaag      3120
     ggcgtatgca ccatgacggc tgccttccta cacttcttct ttctgtcctc cttttgctgg      3180
     gtgcttacag aggcctggca atcctatctg gctgtcatcg ggcggatgcg cacccgcctg      3240
     gttcgcaagc gcttcctctg cctgggctgg ggtctacctg ccctggtggt ggctgtgtct      3300
     gttggcttta ctcgcaccaa aggatatggt acatccagct actgctggct gtccctagag      3360
     ggcggcctgc tctatgcctt cgtgggtcca gcagcagtca ttgtcctggt gaacatgctc      3420
     atcgggatta tcgtcttcaa caagctcatg gctcgcgatg gcgtctcaga caaatctaag      3480
     aagcagaggg ctggccgact gtcttggaat ctctggggat atggctctca actgtgtctt      3540
     tttccaaagc ttccaagggc ttcactctgg agttcctgcg tggtactgcc tctcctggcg      3600
     cttacctgga tgtctgccgt cctggccatg acagatcgcc gctccgtcct cttccaggca      3660
     ctctttgccg ttttcaactc tgcacaaggc tttgtcatca ccgctgtgca ctgcttcctg      3720
     cgccgagagg tccaggatgt ggtaaagtgt cagatgggtg tgtgtcgggc tgatgagagt      3780
     gaagactccc cagactcgtg caagaacggg cagctgcaga tcctgtcaga ctttgaaaag      3840
     gacgtggatc tggcttgtca gacagttctg ttcaaggagg tcaacacctg caacccgtcc      3900
     accattaccg gcactctgtc ccgcctgtct ctggatgagg atgaggagcc caagtcctgt      3960
     ctcgtgggtc ctgagggtgg cctcagcttc tcaccactgc ctgggaacat cctggtaccc      4020
     atggcagcct caccaggtct aggggagcca ccaccacccc aggagaccaa ccctgtgtac      4080
     atgtgtgggg agggtggcct gcggcagttg gaccttacat ggatacggca gagtgaacca      4140
     ggctctgagg gggactacat ggttctgccc cggcggactt tgagcctgca gcctggtggt      4200
     gggggtacag cgggtgagga ggccccaagg gcccggcctg aggggacccc ccggcgggct      4260
     gccaaaacgg tagcccacac tgaaggctac cccagcttcc tgtctgtgga gcactcgggt      4320
     ctagggctgg gccctgccta tgggtctctc cagaacccgt atggaatgac cttccaacca      4380
     ccaccaccaa cacccagcgc ccgccaagta ccagagccag gagaacgtag ccggaccatg      4440
     ccccgtacag tgcctggttc caccatgaag ctgggctccc ttgagcgaaa gaagcttcgg      4500
     tattcggact tggactttga gaaggtgatg cacactcgga aacggcactc ggaactctac      4560
     cacgaactca accagaagtt ccacactttc gaccgctacc gtagccagtc ctcagccaag      4620
     gagaaaccca gcccccccgg gggacgccct ggcttgtccc agcacaggag gcatcaaagc      4680
     tggagcacct tcaaatctat gacactgggc tcactgcccc ccaagccccg agaacggctg      4740
     gccctgcacc ggacagcagc ctgggagccc acagaaccgc cagacggcga cttccagaca      4800
     gaggtgtgag tgccacgccg gactgcccac tgcacagaaa tatatatcta ttttcacact      4860
     ccactttgga actaccagga gccagcgccc ctccccctcc cgaggctggg caggaggcgc      4920
     agaggactca gcctggctgg gggcagccag actggcaggg cctggggggc cagggcccct      4980
     ccttgttctc agaggtccct tagccaccca ctggagcctc atctttgccc cggcctgtct      5040
     gtccctgtcc tgggctgggg aggggggagg gaaactttgt tgggaataaa cttcactctg      5100
     tggaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa           5155
//


spacer
spacer