spacer

EBI Dbfetch

ID   BC056867; SV 1; linear; mRNA; STD; HUM; 1904 BP.
XX
AC   BC056867;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation
DE   protein, theta polypeptide, mRNA (cDNA clone MGC:64844 IMAGE:6164592),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1904
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1904
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8bcddbf2986ad245b17280bd9d1c5b16.
DR   Ensembl-Gn; ENSG00000134308; homo_sapiens.
DR   Ensembl-Tr; ENST00000238081; homo_sapiens.
DR   Ensembl-Tr; ENST00000381844; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC/DCTD/DTP
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 119 Row: n Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21464103.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1904
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_72"
FT                   /clone="MGC:64844 IMAGE:6164592"
FT                   /tissue_type="Skin, melanotic melanoma."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1904
FT                   /gene="YWHAQ"
FT                   /note="synonyms: HS1, 1C5"
FT   misc_difference 29
FT                   /gene="YWHAQ"
FT                   /note="'T' in cDNA is 'C' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 119..124
FT                   /gene="YWHAQ"
FT                   /note="6 bases in cDNA are not found in the human genome.
FT                   The chimpanzee genome agrees with the cDNA sequence,
FT                   suggesting that this difference is unlikely to be due to an
FT                   artifact."
FT   CDS             133..870
FT                   /codon_start=1
FT                   /gene="YWHAQ"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, theta polypeptide"
FT                   /db_xref="GOA:P27348"
FT                   /db_xref="H-InvDB:HIT000259592.14"
FT                   /db_xref="HGNC:HGNC:12854"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="PDB:2BTP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27348"
FT                   /protein_id="AAH56867.1"
FT                   /translation="MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLS
FT                   VAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKY
FT                   LIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPT
FT                   HPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLR
FT                   DNLTLWTSDSAGEECDAAEGAEN"
FT   misc_difference 1890..1904
FT                   /gene="YWHAQ"
FT                   /note="polyA tail: 15 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1904 BP; 537 A; 428 C; 415 G; 524 T; 0 other;
     gatcaaagtg gtgggactcg cgtcgcggtc gcggagacgt gaagctctcg aggctcctcc        60
     cgctgcgggt cggcgctcgc cctcgctctc ctcgccctcc gccccggccc cggccccggc       120
     cccgcgcccg ccatggagaa gactgagctg atccagaagg ccaagctggc cgagcaggcc       180
     gagcgctacg acgacatggc cacctgcatg aaggcagtga ccgagcaggg cgccgagctg       240
     tccaacgagg agcgcaacct gctctccgtg gcctacaaga acgtggtcgg gggccgcagg       300
     tccgcctgga gggtcatctc tagcatcgag cagaagaccg acacctccga caagaagttg       360
     cagctgatta aggactatcg ggagaaagtg gagtccgagc tgagatccat ctgcaccacg       420
     gtgctggaat tgttggataa atatttaata gccaatgcaa ctaatccaga gagtaaggtc       480
     ttctatctga aaatgaaggg tgattacttc cggtaccttg ctgaagttgc gtgtggtgat       540
     gatcgaaaac aaacgataga taattcccaa ggagcttacc aagaggcatt tgatataagc       600
     aagaaagaga tgcaacccac acacccaatc cgcctggggc ttgctcttaa cttttctgta       660
     ttttactatg agattcttaa taacccagag cttgcctgca cgctggctaa aacggctttt       720
     gatgaggcca ttgctgaact tgatacactg aatgaagact catacaaaga cagcaccctc       780
     atcatgcagt tgcttagaga caacctaaca ctttggacat cagacagtgc aggagaagaa       840
     tgtgatgcgg cagaaggggc tgaaaactaa atccatacag ggtgtcatcc ttctttcctt       900
     caagaaacct ttttacacat ctccattcct tattccactt ggatttccta tagcaaagaa       960
     acccattcat gtgtatggaa tcaactgttt atagtctttt cacactgcag ctttgggaaa      1020
     acttcattcc ttgatttgtg tttgtcttgg ccttcctggt gtgcagtact gctgtagaaa      1080
     agtattaata gcttcatttc atataaacat aagtaactcc caaacactta tgtagaggac      1140
     taaaaatgta tctggtattt aagtaatctg aaccagttct gcaagtgact gtgttttgta      1200
     ttactgtgaa aataagaaaa tgtagttaat tacaatttaa agagtattcc acataacttc      1260
     ttaatttcta cattccctcc cttactcttc gggggtttcc tttcagtaag caacttttcc      1320
     atgctcttaa tgtattcctt tttagtagga atccggaagt attagattga atggaaaagc      1380
     acttgccatc tctgtctagg ggtcacaaat tgaaatggct cctgtatcac atacggaggt      1440
     cttgtgtatc tgtggcaaca gggagtttcc ttattcactc tttatttgct gctgtttaag      1500
     ttgccaacct cccctcccaa taaaaattca cttacacctc ctgcctttgt agttctggta      1560
     ttcactttac tatgtgatag aagtagcatg ttgctgccag aatacaagca ttgcttttgg      1620
     caaattaaag tgcatgtcat ttcttaatac actagaaagg ggaaataaat taaagtacac      1680
     aagtccaagt ctaaaacttt agtacttttc catgcagatt tgtgcacatg tgagagggtg      1740
     tccagtttgt ctagtgattg ttatttagag agttggacca ctattgtgtg ttgctaatca      1800
     ttgactgtag tcccaaaaaa gccttgtgaa aatgttatgc cctatgtaac agcagagtaa      1860
     cataaaataa aagtacattt tataaaccaa aaaaaaaaaa aaaa                       1904
//


spacer
spacer