Dbfetch

ID   BC056376; SV 1; linear; mRNA; STD; MUS; 4652 BP.
XX
AC   BC056376;
XX
DT   13-AUG-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus myotubularin related protein 1, mRNA (cDNA clone MGC:73476
DE   IMAGE:6849757), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4652
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4652
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (11-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e4ae3632477a3d6aea6797bd1f6b7cee.
DR   Ensembl-Gn; ENSMUSG00000015214; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035782; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035765; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035687; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035752; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035455; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036282; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034747; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035430; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035583; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035534; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035672; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035569; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036303; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034447; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034889; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000015358; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096290; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0096379; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0096320; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096303; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095854; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096812; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096448; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095774; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095978; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095824; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0096012; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095787; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097156; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095865; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094833; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 8393793.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4652
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FY0"
FT                   /clone="MGC:73476 IMAGE:6849757"
FT                   /tissue_type="Brain, mouse, 13.5,14.5,16.5,17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4652
FT                   /gene="Mtmr1"
FT   CDS             156..2165
FT                   /codon_start=1
FT                   /gene="Mtmr1"
FT                   /product="myotubularin related protein 1"
FT                   /db_xref="GOA:Q9Z2C4"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="InterPro:IPR030587"
FT                   /db_xref="MGI:MGI:1858271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2C4"
FT                   /protein_id="AAH56376.1"
FT                   /translation="MDRPVAAAAAASAASCEGAGGPGPGPGASWRPSRVAGGASASSRH
FT                   PSIETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPL
FT                   FPGESIKAIVKDVIYICPFMGAVSGTLTVTDFKMYFKNVERDPHFVLDVPLGVISRVEK
FT                   IGAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQRKLGIFENLNKHAFPLSNGQVLFAFNY
FT                   KEKFPVNGWKVYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLS
FT                   KVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHK
FT                   LTIFDARQNSVADTNKAKGGGYENESAYPNAELIFLEIHNIHVMRESLRKLKEIVYPSI
FT                   DESHWLSNVDGTHWLEYIRVLLAGAVRIADKIESGKTSVVIHCSDGWDRTSQLTSLAML
FT                   MLDSYYRTIKGFEALIEKEWISFGHRFALRVGHGDDNHADADRSPIFLQFIDCVWQMTR
FT                   QFPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQRIKEDVYTNTISLWSYINSQLDEF
FT                   SNPFFVNYENHVLYPVASMSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAIKAELQKR
FT                   VEDLQREMATRTISSSSERGSSPTHSATPVHTSV"
FT   misc_difference 4635..4652
FT                   /gene="Mtmr1"
FT                   /note="polyA tail: 18 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4652 BP; 1282 A; 988 C; 1046 G; 1336 T; 0 other;
     gggtaacgcg gggccgccag gtgacagcta atggcggcgg ccgcttgacg cgagcggtca        60
     agcagcgaag cagggcggca gggggcgcgt cggggagcct ggctgccgct gcactccgga       120
     ctgtggctca ccggaggcgc cgggcttgac gcgtcatgga caggccagtg gcggcggcgg       180
     ccgccgcatc tgcggcgagc tgcgagggcg ctgggggccc ggggccaggg ccgggcgcta       240
     gctggagacc ctctcgggtt gcggggggcg cctcggccag ctcccggcac cccagcattg       300
     agacccttga cagtcctaca gggtcacatg ttgaatggtg taaacagctt atagctgcta       360
     caatttctag tcagatttca ggttcagtga catcagaaaa tgtgtcaaga gattacaagg       420
     ctctaaggga tggaaataaa ctggcacaga tggaagaagc tccacttttc ccaggagaat       480
     caattaaggc cattgtgaaa gacgtcattt atatctgtcc atttatggga gcagtgagtg       540
     ggaccctgac agtgacggac tttaaaatgt acttcaaaaa tgtagaaagg gacccacatt       600
     tcgtccttga tgttcctctt ggagtgatca gcagagtgga gaagattggt gcacagagcc       660
     atggggataa ttcttgtggt atagagattg tgtgcaagga tatgaggaac ctgagacttg       720
     catataagca ggaagaacag cgaaaacttg ggatatttga aaacctcaac aagcatgctt       780
     ttcctctttc caatgggcag gtgctatttg cattcaacta taaagaaaag tttccagtta       840
     atggctggaa agtttatgat ccagtgtctg aatataagag acagggcttg ccaaatgaga       900
     gttggaaaat atcaaaaata aacagtaatt atgagttctg tgatacctat cctgccatca       960
     ttgttgtgcc aactagtgtg aaagatgatg acctttcaaa agtggcagcc tttcgagcga      1020
     aaggcagagt ccctgtgttg tcatggattc acccagaaag tcaggcaaca attacacgtt      1080
     gcagccagcc attagtgggt cccaatgata aacgctgcaa agaagatgag aaatacctgc      1140
     agacaataat ggatgctaat gcacagtcac ataaacttac tatctttgat gccagacaaa      1200
     acagcgttgc tgataccaac aaggcaaagg gtggtggata tgaaaatgaa agtgcttacc      1260
     ctaatgccga actcatattc ttggagatcc acaatattca tgtgatgagg gagtcacttc      1320
     gtaaattaaa ggagattgtg tatccttcaa ttgatgagtc acattggcta tccaatgtgg      1380
     atgggacaca ttggctggaa tatatacggg ttctccttgc tggggcagtg agaattgctg      1440
     ataaaataga atctgggaaa acttccgtgg tcatccactg cagtgatggg tgggatcgaa      1500
     catcccagct cacatctctg gcaatgctga tgttagacag ttattaccgg accattaaag      1560
     gatttgaggc tctcatagaa aaggagtgga taagctttgg acacaggttt gccctgagag      1620
     tgggccatgg tgatgacaac catgcagatg ctgaccgatc acctatattt cttcagttta      1680
     ttgattgtgt ttggcagatg acaagacagt tcccttcagc atttgagttt aatgaattat      1740
     tcttgattac aattttggat cacctctata gttgtctttt tgggaccttt ttgtgcaact      1800
     gtgaacaaca gcgaatcaaa gaggatgtat atacaaatac tatatcttta tggtcttata      1860
     tcaatagcca actagatgaa ttctcaaatc ccttctttgt gaattatgag aaccatgtgt      1920
     tatatcctgt tgctagtatg agtcacttgg aattgtgggt aaattattat gtacggtgga      1980
     atccacggat gagaccacag atgccaattc atcagaatct caaggaactg ctggctatca      2040
     aggctgagct gcagaagcgt gtggaggact tgcagcggga gatggccacc cggaccatct      2100
     catcttcctc tgagaggggc tcctcaccta cccactcagc tactcctgta cacacctcag      2160
     tctgatgaac aaagccagta ccccgggcca tccggctgct ctattgtctt ccagcagctc      2220
     ggggacctgg ccattgatat tatggttcta gcttgtcatc ttagctctta ggactcagcc      2280
     cagggaccat ttgtgggtgg tgaaagctcc tattattaac aagtacttct tttgtgtgaa      2340
     cagcctgtgc cccttttgcg agcagcctca ccctgtgaac cacctgtgtc ttgtacaggt      2400
     agcttgggag aaaccagatt gaatgcagtg cggtatttta acttaagaga atcttacacc      2460
     acttctttcc aagttacatc ctttgttacg aacaactcgt ttacttatag aacacatcac      2520
     cagccatgtg gctcctctca gccttttggc acaatttaaa aactgtttta aatgaaatgt      2580
     tagtgtggca aatgaaccat tgccacctgt tctacagtta tcagttatct tcatacaaga      2640
     agtcctgttc aactggtaca atatgtactg ctgtgtacat ataaggtatt ttttaaagag      2700
     aaacatgcct ttattttcct atgtcctttt ttatgtttag aatagcctga gaaatcatct      2760
     gctaaactgt gctgtaggag aaattctttc ccaacggagt ccatgctgcc ttttgcgcag      2820
     cacatttgaa ttaagattcg agatgtgtca gctcagtggc aatggagtgt tgtcctctaa      2880
     ctctggtact tgtcttttga gatggcacag cccattcatt cattggtggt agcagcaggt      2940
     tccctcagga tgcagcaaac tatgaatgct cagtcctctg gccttgtcgc aggtaaactg      3000
     agggctcagg cagcaactct gcatttgttg gcctccctct atgacagctc tctaaaggag      3060
     caagtcttga aaattgcttt ggcatcctac cacctgttaa gatgcccagc atctatgtca      3120
     aatcaagtcg tctctcacct gttagacacc tggacagctt gctttcattt accacgatct      3180
     cttctcagtt gatttacatg actgcctggc catactttaa ggcaaccagt ggctaaaata      3240
     ctcatgaaat taaatatcag tgattgcact gaactgtata cttcagatga gctaatttta      3300
     ctacgttaat ttagcattta tttaagtgga gaattaatta gttttgtatt ccctatttta      3360
     caaaaattga taaagatata gttcatggat tttattctgc tgttatgggt ttatttctat      3420
     gggtctgaaa gcataacatg ctcttccatg gttttcccct ctcggaccca gccctggctt      3480
     ggcaggcctc tttccacagt taacagtgtt gatctctgct actcaaccag tccttctagg      3540
     aatgaatctc ccatcagctt cgacgtgtgc aatgccagca tagccaccac caccaccatg      3600
     tccacttctg tgtgtcacca ggcccttcag agttggagat gtgtttgagg ctgaccaagt      3660
     gagcccctga ggacagatgg ctcacatctt cctcttgtca gtgtcaaatc actggatgct      3720
     gtgcagtcct acacattaac ctcggttttc aaaagtgttc ttaaaagaat ttttacagcc      3780
     aaatacatag aaactagatg atttttcaac ttacagaaaa ctacccaact ataagataac      3840
     cagagacatt tattcaagga agtttcataa gttatgatca attctccatt tttaatcatc      3900
     tgggggattt gtttctaaac tacagtttaa gtgattttag cttttgattt gtgttcatca      3960
     tagatataaa accttatttg tagatggata aactgccata tctgaggtag gagaagctgt      4020
     gagttcaggg acagctttgg ctacatatcg agttctggga cagctggcct atattgtgga      4080
     gccctgtctc aaaatcaata ccaaaaagaa aataacatga actataatat tttttttctt      4140
     catatacttt ttaaaagtgg ggacatttac caatttttcc ctagaaatac tgtgtaattt      4200
     cccagcgaca cttgaactat tgaagataga gtggactgga taatgttttg acagaaccag      4260
     agaagccatg gggatggctg cttgttgagg tcagctagcc tggtacagat ggctggtaaa      4320
     ctgtggctct ggctcctgct caagccatgg cctcccagct gccatgcctg cagcacccct      4380
     aaaaatgtcc actggatttt aaagaagcac aacagagtct ttccctttgt atgtttctag      4440
     cacagaactg tttctaaaac aacttgaagt atagttttct tatctaaaca attctttcat      4500
     gtatgtttta tttaagtact ataatgtaaa ccctttaagg ttcaggtttt taaacaagta      4560
     caatactgta tttgcctcat ctgaagcact gtattccaac atgtaactaa aatgataata      4620
     tgtttgctcc ctggaaaaaa aaaaaaaaaa aa                                    4652
//