spacer

EBI Dbfetch

ID   BC056357; SV 1; linear; mRNA; STD; MUS; 2700 BP.
XX
AC   BC056357;
XX
DT   13-AUG-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus glutathione reductase, mRNA (cDNA clone MGC:73453
DE   IMAGE:6813295), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2700
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2700
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (11-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5603f8507057cb069f33a6cc73bc3156.
DR   Ensembl-Gn; ENSMUSG00000031584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033992; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAV Plate: 158 Row: h Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328488.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2700
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FW0"
FT                   /clone="MGC:73453 IMAGE:6813295"
FT                   /tissue_type="Brain, mouse, 13.5, 14.5, 16.5, 17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2700
FT                   /gene="Gsr"
FT   CDS             303..1805
FT                   /codon_start=1
FT                   /gene="Gsr"
FT                   /product="glutathione reductase"
FT                   /db_xref="GOA:P47791"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="MGI:MGI:95804"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47791"
FT                   /protein_id="AAH56357.1"
FT                   /translation="MALLPRALGVGAAPSLRRAARALTCAMASPGEPQPPAPDTSSFDY
FT                   LVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDH
FT                   VDYGFQSCEGKFSWHVIKQKRDAYVSRLNTIYQNNLTKSHIEIIHGYATFADGPRPTVE
FT                   VNGKKFTAPHILIATGGVPTVPHESQIPGASLGITSDGFFQLEDLPSRSVIVGAGYIAV
FT                   EIAGILSALGSKTSLMIRHDKVLRNFDSLISSNCTEELENAGVEVLKFTQVKEVKKTSS
FT                   GLELQVVTSVPGRKPTTTMIPDVDCLLWAIRRDPNSKGLNLNKVGIQTDEKGHILVDEF
FT                   QNTNVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPI
FT                   GTVGLTEDEAVHKYGKDNVKIYSTAFTPMYHAVTTRKTKCVMKMVCANKEEKVVGIHMQ
FT                   GIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR"
FT   misc_difference 1236
FT                   /gene="Gsr"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'R' in cDNA, 'G' in the mouse genome."
FT   misc_difference 2599
FT                   /gene="Gsr"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 2674..2700
FT                   /gene="Gsr"
FT                   /note="polyA tail: 27 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2700 BP; 646 A; 643 C; 696 G; 715 T; 0 other;
     gtttagttgg cagctccatc tcagtccgtt ctttaagctt cctctatgga tcacaaaaaa        60
     tcatttcggc cactccactc attattccag cctttttttc ttcttcattt tacgagtacc       120
     aagtgccctg aaagcggaaa gtaggttaag gcctgcagga atccgagaag ctgggggtgg       180
     ggaaacaaaa cctgcacgtt ctcgccctcg gtccacgcgc tgcggggcgg ggacaggggc       240
     cctcgggcgc ggtgcttagt cacggcgacg ctgcaccccg ctcccggcgc gcacttccgc       300
     gcatggcgct gctgccccgg gcgctgggcg tgggcgcggc cccgagcctg cggcgggcag       360
     cgcgcgcgct cacctgcgcc atggcgagtc ccggcgagcc gcagcccccg gccccggaca       420
     cctcttcctt cgactacctg gtgatcggcg gcggctccgg cgggctggcc agcgcgcggc       480
     gggcggcgga gctcggcgcc agggccgcgg tggtggagag tcacaagctg ggtggcactt       540
     gcgtgaatgt tggatgtgta cccaaaaagg taatgtggaa cacagcagtg cactcggaat       600
     tcatgcacga tcacgtggat tacggctttc aaagctgtga gggtaaattc agttggcatg       660
     tcatcaagca gaaaagggat gcctatgtga gccgcctgaa caccatctat caaaataatt       720
     taaccaagtc tcacatagaa attatccacg gctatgcaac attcgcagat ggtcctcggc       780
     ccacggtgga agtcaatggg aaaaagttta ccgctccaca catcctgatt gccacaggag       840
     gcgtgcccac agttcctcac gagagccaga tcccaggcgc cagcctgggg atcaccagtg       900
     atggcttctt tcagctggag gacttgccca gccgcagcgt catcgtgggg gccgggtaca       960
     ttgctgtgga gatcgcgggc atcctctctg ccctgggctc caagacatct cttatgatca      1020
     ggcatgataa ggtactgaga aattttgatt cactcatcag ttccaactgc accgaggaac      1080
     tggagaatgc cggcgtggag gtgttgaagt tcacacaggt taaggaagta aaaaagacat      1140
     catcaggcct ggagctccaa gtggtgactt ccgtgcctgg taggaagccc accacgacca      1200
     tgattccaga tgttgactgc ctgctctggg ccattcgacg ggacccaaat tctaagggcc      1260
     tgaatctgaa taaagtgggc attcagacgg atgaaaaggg ccacatccta gtagacgaat      1320
     tccagaatac caatgtcaaa ggcgtctatg ctgtgggaga cgtctgtggg aaagcgcttc      1380
     tcaccccagt tgcaatcgct gctggccgga aacttgccca tagactgttt gaatgcaaac      1440
     aagattccaa attagactat gacaacatcc ctactgtggt cttcagccac ccccctattg      1500
     ggaccgtggg gctcactgaa gacgaagctg ttcataagta tgggaaagac aatgtgaaaa      1560
     tctactcgac tgcctttacc ccgatgtatc acgctgtgac cacgaggaag acgaaatgcg      1620
     tcatgaagat ggtttgtgcc aacaaagagg aaaaggtggt tggcattcac atgcagggga      1680
     ttggctgtga tgagatgctg cagggcttcg ctgtagcggt gaaaatgggg gccaccaagg      1740
     ccgacttcga caacacagtt gccattcatc ctacctcttc agaggagctg gtcaccctgc      1800
     gctgagagcc tggggaccca ggtggctagc ggtgcgacca gcaggcctcc gggaggaacc      1860
     gatcgagttt acgcccagct tctacagatc tctgtatttt aatcaggaat ttctggtggt      1920
     gtaaatttcc agctatacac acgcacagaa gaacttatgt atctaatcag aaggttgttt      1980
     tgttaatccg gggttggttt tcatttgata atatttataa ttaatatttt gatttttttg      2040
     ttgttgttta attaacagcc ttgtgtttgt tgtgtttttc ttgctttggc cccattccaa      2100
     gtttaaatgt acatgacata cactcaagtt agtgtacctg atggatgaat attgctggct      2160
     aatttctttt attttttatt tttttccttt ttttatgcag cccaaggtgg cctcaaacaa      2220
     ctcagaatcc tccagctata gcctcatggg tgctggaatt ctaggcctgc atggcctctc      2280
     ctggcctagc ttgctagttt tatatgatgg gaagtctgca gaatatacgt ggtatttttg      2340
     ttctgtattg gaaagctgcc ccaatgttac ctctctattc ttgttttatt ctttgctctg      2400
     tgttaaatga tttaaaatgg tttgtgttat tttcatggaa caaagtgcat taaagttaga      2460
     cttgaggctg gttaggtaaa ggagaaatga cagtacatgc aagacggaag gctgaggcac      2520
     tcgggagccc tttcttcttc tgagtattcc tggttcattc agtcatttct gtatctctgc      2580
     gtttgttttt tttttttttg ttttgttttt tatgaaaact gttccaaatt tttgaaattc      2640
     actgcattgt cttataaaat ttattacgaa ctaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2700
//


spacer
spacer