Dbfetch

ID   BC056341; SV 1; linear; mRNA; STD; MUS; 2843 BP.
XX
AC   BC056341;
XX
DT   13-AUG-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus inositol polyphosphate-5-phosphatase A, mRNA (cDNA clone
DE   MGC:73425 IMAGE:5703345), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2843
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2843
RA   Strausberg R.;
RT   ;
RL   Submitted (11-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; d05ffa53bb5124ef171e9d3aeb13244e.
DR   Ensembl-Gn; ENSMUSG00000025477; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033150; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033132; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033064; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033133; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032847; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033644; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032177; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032820; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032972; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032925; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033066; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032957; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033664; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031883; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032288; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000106098; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087316; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087402; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087340; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087360; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0086921; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087861; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087447; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086864; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087060; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086904; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087091; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0086940; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088159; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0086851; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0085960; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2843
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EW0"
FT                   /clone="MGC:73425 IMAGE:5703345"
FT                   /tissue_type="Brain, mouse 15.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2843
FT                   /gene="Inpp5a"
FT   CDS             282..1520
FT                   /codon_start=1
FT                   /gene="Inpp5a"
FT                   /product="Inpp5a protein"
FT                   /db_xref="GOA:Q7TNC9"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="MGI:MGI:2686961"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TNC9"
FT                   /protein_id="AAH56341.1"
FT                   /translation="MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVLHTHK
FT                   PHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTAL
FT                   GSFYFLHESLKNIYQFDFKAKKYKKVTGKEIYSDTLESTPMLEKEKFPQDYFPECKWSR
FT                   KGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGVRHKALGYVLDRIIDQRF
FT                   EKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVVLQL
FT                   EKKLFDYFNQDVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDSSQGEQYM
FT                   NTRCPAWCDRILMSLSAKELVLKSESEEKVATYDHIGPNVCMGDHKPVFLAFRIAPGAG
FT                   KPHAHVHKCCVVQ"
FT   misc_feature    303..1481
FT                   /gene="Inpp5a"
FT                   /note="IPPc; Region: Inositol polyphosphate phosphatase,
FT                   catalytic domain homologues"
XX
SQ   Sequence 2843 BP; 679 A; 775 C; 745 G; 644 T; 0 other;
     cggcggcggc tgcgggaact ttcccggcgg gtctaatggc tgcgcgcggg ccgctgtgag        60
     gcgcggcggc gagcgggcgc ggggccgcgg agcagcgaag agccgcgacc gcgaggctgg       120
     agccccggcc aggcccggtc cgacccgcca agcccgcgat gcgcccctgt gctgtccccc       180
     ggcgcagctg acgccccgcg gccccgcgag accccagccc taccggcccc gcaggaagcg       240
     gccgccgcca cccagtccag agcccgctcc gcccgggcac catggcgggg aaggcggccg       300
     cccccggcac cgcggtcctg ctggtcacgg ccaacgtggg ctcgctcttc gacgacccag       360
     aaaacctgca gaagaactgg cttcgggaat tttaccaggt cctgcacaca cacaagcctc       420
     acttcatggc cttgcactgc caagaatttg gagggaaaaa ctacgaggcc tccatgtccc       480
     atgtggacaa atttgtcaaa gaactactat ccagtgacgc aatgaaagaa tacaacaggg       540
     cgcgtgtcta cctggatgaa aactacaagt cacaggaaca cttcacggca ctaggaagct       600
     tttattttct tcacgaatcc ttaaaaaaca tctaccagtt tgactttaaa gctaagaagt       660
     ataaaaaagt cactggcaag gagatctatt cggacacttt ggagagcaca cccatgctgg       720
     agaaggagaa gttcccacag gactactttc ctgagtgcaa atggtcaaga aaaggcttca       780
     tcaggacgcg gtggtgcatt gctgactgtg ccttcgactt ggtgaacatt catctttttc       840
     atgatgcatc caacttagtg gcctgggaga caagcccctc agtgtactcc ggtgtcaggc       900
     acaaggctct gggctatgtg ctggacagaa tcatcgacca gcgatttgag aaagtttcct       960
     actttgtctt cggtgatttc aacttccgcc tggattccaa gtctgtcgta gagacactct      1020
     gcacaaaggc cacaatgcag acagtccgcg ctgctgatac caatgaagtt gtaaagttga      1080
     tatttcggga gtcagacaat gaccggaagg tcgtgctcca gttggaaaag aagctcttcg      1140
     actacttcaa ccaggatgtc ttccgggaca acaacggcac tgcgctcttg gaatttgaca      1200
     aggagttgtc tgtctttaag gacagactgt atgaactgga catctcattc ccccccagct      1260
     acccgtacag tgaggactcc agccagggag aacagtacat gaacacgaga tgccctgctt      1320
     ggtgtgatcg catcctcatg tccctgtctg ccaaggagct ggttcttaag tcagagagcg      1380
     aggagaaggt tgccacctac gaccacatcg ggcctaatgt ctgcatggga gaccacaagc      1440
     cggtgttcct ggccttccga atcgcacctg gggcaggtaa acctcacgcc catgtacaca      1500
     agtgttgtgt cgtgcagtga cgtggtggga agaggtgcca gcgccgcgag aggatcctcg      1560
     agaggcctcc ctgtagcagt gtatccaact catcctccta acagctgcat cggaaccgcc      1620
     caagcctcac ctgctagacg gccggcccca cacttcgctt cagcctccgg acctccggaa      1680
     agcctcacat acctcactgt cgtgtctgtc acgtgacatt gtagacatat tgggtgtaat      1740
     caagccacag tcctattgcc aaaactctaa cagacagcag agcgcctgta ttttagactt      1800
     cacagttttc catttttaac aattgtctgt ggaggaagct tctccattta gagccccagg      1860
     tgtccagcgt ccctctctgc caggaggagt gtgccgggca ctagcccagg cagccaggct      1920
     gccacgtgtg cccaagcccg aggcccgagg tctgactcta ctgccatgtt acgtggcgtg      1980
     agaatcacac tgcagctgct ttccattttt atatatataa atacatataa atatatactt      2040
     tttaaaaata atttataaat cttaccaaaa cttatgctga atatactttc cagtatgagt      2100
     gcacgagtgt cctgagcagg cagaaccgca gtctagatga atggcgactc catcagcagt      2160
     cggcacctgt tcctgagaca aggcctagcc agtgcccagg gcgaggggcc ctgtgatctg      2220
     cctgtactag cagtttgtca ctcttctgcc ttttctgtgt aatattaaga actgaatgtg      2280
     aagtttatag ctagcctggg tgtacctttt aagaattttg taaactgttt tgtctgtctt      2340
     ttgttaccgt tttatggtgc caagtagcct acattaaaac cataatcttg tgggagaatt      2400
     agaagtagcc tcgtccactt cccacagatt gcttctagca tgggctgtgt gtaaacctgg      2460
     cagaaaagcg acgggtgatg ctgggcacag cctgttgcct ggactagcac ccagcactga      2520
     gaaccacgga aggcgcctgc ggagcctgct gaggaaacac agcgtgcttt tattgattta      2580
     cttctgaaca ctacagttcc tggatggggc ggaggcgcga gttaatgtcg gtttccctag      2640
     aaatcactca aggccggcct gtgtccttga tgccagggtc gggtctgtga ctgccatggt      2700
     cgctgcttgc caatgtgcca tgtccgcagc ggttgtccgt gggttccagc tgtgggtcct      2760
     tcccgtgaag gcctctggaa gtgactgctc ggttcctaag caataaaatt gatcatggtg      2820
     aaaacaaaaa aaaaaaaaaa aaa                                              2843
//