spacer

EBI Dbfetch

ID   BC055809; SV 1; linear; mRNA; STD; MUS; 1888 BP.
XX
AC   BC055809;
XX
DT   05-AUG-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus chromatin modifying protein 2B, mRNA (cDNA clone MGC:67644
DE   IMAGE:6414077), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1888
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1888
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ae7fa0651f3cdf24e80ff1a199b5c5a3.
DR   Ensembl-Gn; ENSMUSG00000004843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004965; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 125 Row: m Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 30794431.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1888
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FR0"
FT                   /clone="MGC:67644 IMAGE:6414077"
FT                   /tissue_type="Brain, pool of enriched mouse brain tissues
FT                   from 13.5,14.5,16.5 and 17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1888
FT                   /gene="Chmp2b"
FT   CDS             219..860
FT                   /codon_start=1
FT                   /gene="Chmp2b"
FT                   /product="chromatin modifying protein 2B"
FT                   /db_xref="GOA:Q8BJF9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="MGI:MGI:1916192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJF9"
FT                   /protein_id="AAH55809.1"
FT                   /translation="MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELE
FT                   IKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMST
FT                   TAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIV
FT                   NQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD"
FT   misc_difference 1873..1888
FT                   /gene="Chmp2b"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1888 BP; 585 A; 392 C; 415 G; 496 T; 0 other;
     caaaaaagtg tcttagttcc cggtcacctg agcacccagg acgcgttctc gggagcctcg        60
     cggagccacg cccgccgcag gtcgagcttg gagaccccgt cctcctcctc ccgccgctgc       120
     caggcttctc cgggatccgt ccttctaccg gtcctgttcc cagaaccggg ccggaccgaa       180
     ccgggccgag ctgggccgcc cgggcgcggc cgctcaccat ggcctccctc ttcaagaaga       240
     agactgtgga cgatgtcata aaggaacaga atcgagagct gcgtggcacc cagagggcca       300
     tcatcaggga ccgagcagcc ttagagaaac aggagaaaca gctggagtta gaaattaaga       360
     agatggccaa gattggtaat aaggaagcgt gcagggtttt agctaagcag cttgtccacc       420
     tacggaaaca gaagacaaga acgttcgctg taagctcaaa agtcacctct atgtccacac       480
     aaacgaaagt gatgaattcc cagatgaaga tggccggtgc catgtctacc actgcaaaga       540
     caatgcaagc agtcaacaag aaaatggatc cacagaagac actacaaaca atgcagaatt       600
     tccagaagga aaacatgaaa atggaaatga ctgaagaaat gatcaatgac accctggatg       660
     acatctttga tggctctgat gatgaagaag aaagccagga catcgtgaat caagttcttg       720
     atgaaattgg gattgaaatc tctggaaaga tggccaaagc tccatcggct gcaagaagct       780
     taccgtctgc ctccacttca aaggctacaa tttctgatga agagattgaa cgtcaactca       840
     aagctttagg ggtagattag atcaaaagcc atacatactg ttctcacttg agtctaaagt       900
     gagtccggtg tagattcctt ttacaaaaca cattcatttt gcaaaaatga agaccatgag       960
     tgaacagtta tttcctgacc catggctact ttgaatcctt tgccaaagag tgccaatgat      1020
     gcaaaaaaca atgggagcag tttggctctt aggtagaagc accctggtct gaggggtgtg      1080
     caagctgagt tcttttgtgc atggcatagg gagacgacgg tgtcactgct tagtgttggg      1140
     ttgggttcta agttgtttta cactgaaatc agacttcatg tttaatgcca ttaggcgtca      1200
     acgtaaagag acttgtaaaa atattaaagg tatatcgtta attctgtatc tgttgcttgt      1260
     cctttgtaga cagttatgtt aggaccatag gcagtgcagc tgccaagtta tttttaaacc      1320
     atctaaaagg agagtgctat ttaaacatct gtcttaaact gtcctgagct tctacttttc      1380
     ttccatttac cccctttggg agaacattct agttggtaag tttattacct ttcaaaatgt      1440
     gcttggcacc tgccttaaat agcacgaaca tattgtgcac atctttaaat taatttaact      1500
     ggcaaaaaaa caattacatt ttaaactaaa actgagactg agaacagtac ccaatctgtc      1560
     ttttaaagct tataaaagtg aatcgggtac aattagcaaa aagaagaaag aagacactga      1620
     atttatgacg ttttacagta atgaagctat actttggtct ttcttccaag aactgcgatt      1680
     tttctctgta tgaattataa cttagtctgt gttggaactt tgaattgtgt aatatacaca      1740
     ttaaaccatc taaattgaag ccattcttct aaaggaagga ctgctacttt gacagtactt      1800
     gatccagatt tctaaagaaa atgtttttgt tttgttgtgt ttttggtaaa taaactgcaa      1860
     ctttgtcaga aaaaaaaaaa aaaaaaaa                                         1888
//


spacer
spacer