spacer

EBI Dbfetch

ID   BC055293; SV 1; linear; mRNA; STD; MUS; 2114 BP.
XX
AC   BC055293;
XX
DT   23-JUL-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus regulator of G-protein signaling 4, mRNA (cDNA clone MGC:62655
DE   IMAGE:6494449), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2114
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2114
RA   Strausberg R.;
RT   ;
RL   Submitted (21-JUL-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; fe384f02501f03f7418efc7bd7761a93.
DR   Ensembl-Gn; ENSMUSG00000038530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027991; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 116 Row: m Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6677742.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2114
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:62655 IMAGE:6494449"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2114
FT                   /gene="Rgs4"
FT   CDS             110..727
FT                   /codon_start=1
FT                   /product="Rgs4 protein"
FT                   /db_xref="GOA:Q5D078"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:108409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D078"
FT                   /protein_id="AAH55293.1"
FT                   /translation="MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKV
FT                   VTCQRVSQEEVKKWAESLENLIHHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSP
FT                   SKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLQPTITCFDEAQKKIFNLMEKD
FT                   SYRRFLKSRFYLDLTNPSSCGAEKQKGAKSSADCTSLVSQCA"
FT   misc_feature    293..640
FT                   /note="RGS; Region: Regulator of G protein signaling
FT                   domain. RGS family members are GTPase-activating proteins
FT                   for heterotrimeric G-protein alpha-subunits"
XX
SQ   Sequence 2114 BP; 587 A; 472 C; 489 G; 566 T; 0 other;
     aggattctga cagcttcttt gcagagcaga agcaactgtg ctcaaaatag aaaccaccgc        60
     ggctcccgct gcctttctct cctcgctaag aatccctcag ttaaacaaga tgtgcaaagg       120
     acttgcaggt ctgccggctt cctgcctgag gagtgcaaag gacatgaaac atcggctggg       180
     gttcctgctg cagaagtcag attcctgcga acacagttct tcacacagca agaaggacaa       240
     agtagtaact tgccagaggg taagccaaga agaagtcaag aaatgggctg aatcgttgga       300
     aaacctgatt caccatgaat gtggactggc agctttcaaa gctttcctga agtcggaata       360
     cagcgaggag aacattgact tctggatcag ctgtgaggag tacaagaaga tcaagtcacc       420
     ttctaaacta agtcccaaag ccaagaagat ctacaacgag ttcatctcag tgcaagcaac       480
     aaaagaggtg aacctggact cttgcaccag agaggagaca agccggaaca tgttacagcc       540
     cacaataacc tgttttgatg aagcccagaa gaagattttc aacctgatgg aaaaggattc       600
     ctaccgccgc ttcctcaagt ctcgattcta tcttgacctg accaatcctt ccagctgcgg       660
     ggcagagaag cagaaaggag ccaagagttc tgcagactgc acttccctgg tctcccagtg       720
     tgcctaattc tcacacagag gcagggagcc caaatgccaa gactctatgc tctgaaaaac       780
     ctgaggccaa atattgatct taagcaccaa tgctttatcc acattgtagc ctagtgtcca       840
     tgctgcctgc cgcgtgtgag tcacttccat gtaaaactag ccttagttgt ggtgttgggg       900
     ttttcactag ggtaagaccc aatttgtttt aaattttccc aagtctcctt aagggtgagc       960
     aagtttccaa ataatggctc cgtaggtctg gattttcaaa gatggctggc agtctgcccc      1020
     tttcaacagt ttgacctcaa gttagttagt tggtacactt catgtgacat tccatgcaca      1080
     tgtaatgttg gccagcagca cttcctacgg actctcaatg tttaggtgat atttgtgtat      1140
     gcatatgtat acattaaaat atacataaca tatgcatata cattctgtat atattatacc      1200
     tatgtattca atgtgtgtga atgtgcatga atatgtatct atctatctat atatgtatat      1260
     actgacacat gcacacacat ttctttaaga aaagatggga aagatcctag gtgctcaaac      1320
     tggagtgtgt agacatgctt gcatgcatgt tctgatttct ggtccttcat accgtgtctg      1380
     aacagggcaa actgaattaa ctgccatgca ggctaagaaa ggaacagtaa cttgtgggga      1440
     atgagttcta tagaaccact gggtcttggc ggagaatagc cagggccttt gtgtttagtt      1500
     gttgatggcc tccacattga gcactaagct aaggggtgag cactctgaaa actctgctgt      1560
     ctgactgaca ctgaactgcc ttgcatcagt gatcactact ggcacttttt aagtccctct      1620
     gctgatggcc ttccctcctt tgcctgggtg ctcagggtgt gctgattagc agctgggttg      1680
     gtctagagct gaatgtttga gctgaatgaa ggaatgtggt ccaggctttg ctgcctagcc      1740
     ctaccaagga ctactgctta ggtgagggca gaggacctaa agattatctt aattctttcc      1800
     tcttttgata aggtgctctt cttttccttc ccctcaagaa tgtcacctgt cagaggagcc      1860
     tccttagttc cctgtggttg gttgttcact ttaaaaacca cggctacctg ccgtggttct      1920
     aagctacatg cctacatctg taaagcatca tcggggggaa aggttatgtt ttatcaggag      1980
     gaaggaagtt ctcatgaact gcaaagccct ctttggtttt ctgctttgag gtaagagctt      2040
     gttcacccca tcccaaacac caaggctagc agagaccaat gaaaggagag aggaaaggaa      2100
     aaaaaaaaaa aaaa                                                        2114
//


spacer
spacer