spacer

EBI Dbfetch

ID   BC054804; SV 1; linear; mRNA; STD; MUS; 5393 BP.
XX
AC   BC054804;
XX
DT   05-JUL-2003 (Rel. 76, Created)
DT   23-MAR-2009 (Rel. 100, Last updated, Version 98)
XX
DE   Mus musculus potassium voltage-gated channel, shaker-related, subfamily,
DE   member 6, mRNA (cDNA clone MGC:64781 IMAGE:6838056), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5393
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-5393
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUL-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cd52bb4e58cd6ba5801bfd6325d2bbe2.
DR   Ensembl-Gn; ENSMUSG00000038077; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112242; mus_musculus.
DR   EuropePMC; PMC1366808; 16143634.
DR   RFAM; RF00485; K_chan_RES.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. James Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAV Plate: 132 Row: d Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328479
CC   The stop codon of the CDS annotated on this record is located > 55
CC   bases upstream of a splice junction, and therefore the mRNA is
CC   predicted to be subject to nonsense-mediated mRNA decay (NMD).
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 37) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5393
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_GH0"
FT                   /clone="MGC:64781 IMAGE:6838056"
FT                   /tissue_type="Brain"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..5393
FT                   /gene="Kcna6"
FT                   /gene_synonym="Kv1.6"
FT                   /gene_synonym="MK1.6"
FT   CDS             271..1860
FT                   /codon_start=1
FT                   /gene="Kcna6"
FT                   /gene_synonym="Kv1.6"
FT                   /gene_synonym="MK1.6"
FT                   /product="Kcna6 protein"
FT                   /db_xref="GOA:Q61923"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003972"
FT                   /db_xref="InterPro:IPR004053"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:96663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61923"
FT                   /protein_id="AAH54804.1"
FT                   /translation="MRSEKSLTLAAPGEVRGPEGEQQDAGEFQEAEGGGGCCSSERLVI
FT                   NISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGG
FT                   RLRRPVNVPLDIFMEEIRFYQLGEEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLL
FT                   FEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRADGRGGSNEGSGTRLSPASRSH
FT                   EEEDEDEDSYAFPGSIPSGGLGTGGTSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVR
FT                   FSACPSKAAFFRNIMNIIDLVAIFPYFITLGTELVQRHEQQSVSGGSGQNGQQAMSLAI
FT                   LRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEA
FT                   DDVDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIV
FT                   SNFNYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRPSYLPTPH
FT                   RAYAEKRMLTEV"
FT   misc_difference 2601
FT                   /gene="Kcna6"
FT                   /gene_synonym="Kv1.6"
FT                   /gene_synonym="MK1.6"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 5355..5393
FT                   /gene="Kcna6"
FT                   /gene_synonym="Kv1.6"
FT                   /gene_synonym="MK1.6"
FT                   /note="polyA tail: 39 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 5393 BP; 1257 A; 1396 C; 1404 G; 1336 T; 0 other;
     ggcagccagt ttcacgcgcg cgacagtttg cgggttccag gcatctcaga aatcctgagc        60
     acggaggcgc ggctattgag agccagagcc acttcccaga cctagcctgg cagagggacc       120
     agctgcaggg ctcaccgacc taaccgccag gtcagagcac gggccccacc ctaaaggagg       180
     gcacagccga agctgtgaag cgggtgccgc tctctggagc tcgtgtcgtg ggcgccgtcc       240
     tagtggcggg gagcgcaccg ccgaggtgac atgagatcgg agaaatccct gacgctggcg       300
     gcgccggggg aggtccgtgg gccggagggg gagcaacagg atgcgggtga gttccaggag       360
     gccgagggcg gcggcggctg ctgtagtagt gagaggttgg tgatcaacat ctccgggctg       420
     cgcttcgaga cgcagctgcg caccctgtcg ctgttccctg acacgctgct aggagaccct       480
     ggccgcagag tccgtttctt tgaccccttg aggaacgagt acttctttga ccgcaaccga       540
     cccagcttcg acgctatcct ttattactat caatctggag gtcgcctgcg caggcctgtt       600
     aatgtgcccc tggacatttt tatggaagag atccgcttct atcagttggg agaggaagcc       660
     ctggcggcct tccgggagga tgagggttgc ctgcccgaag gtggcgagga tgagaaacca       720
     ctcccctccc agcctttcca gcgacaggtc tggcttctct ttgagtaccc ggagagttcc       780
     gggcccgccc gaggcatcgc catcgtctca gtattggtca tcctcatctc catcgtcatc       840
     ttttgcctgg agaccttgcc tcaattccgt gcagatgggc gcggtggaag caacgagggt       900
     agtgggaccc gcttgtctcc ggcctccagg agccacgagg aagaagatga ggatgaagat       960
     tcctatgcat ttcctggtag cattccctct ggggggttgg ggactggagg aacatcttca      1020
     cttagtactc tcgggggttc tttcttcaca gaccccttct tcttggtgga aactctgtgt      1080
     atcgtctggt tcacgtttga gctcctggtg cgcttctctg cctgtcccag caaggcggcc      1140
     ttctttcgca atatcatgaa catcattgac ttggtggcca ttttccccta ctttatcacc      1200
     ttgggcaccg agctagtgca acgtcacgag cagcagtctg tgagtggtgg cagtggtcag      1260
     aatgggcagc aggccatgtc cctagccatc ctcagggtga tccgcctggt ccgggtgttc      1320
     cgaatcttca agctctcccg ccattccaag gggctgcaga tcctgggtaa gaccttacag      1380
     gcgtccatgc gggagctcgg gctgctcatc ttcttcctct tcatcggagt catcctcttt      1440
     tccagcgctg tctacttcgc agaggctgat gatgttgact cgctcttccc tagcatccca      1500
     gatgccttct ggtgggctgt ggttacaatg accacggtag gttatgggga catgtacccc      1560
     atgacggtag ggggcaagat tgtgggctca ctgtgcgcca ttgctggggt cctcaccatt      1620
     gcattaccgg taccggtcat tgtctccaat ttcaactact tctaccaccg agagacggag      1680
     caggaggagc aaggccagta tacccacgtc acttgtgggc agcccactcc ggacttgaag      1740
     gcaacggaca atgggcttgg caaacctgac tttgccgagg cttcacggga acgccggccc      1800
     agctaccttc cgactccaca tcgagcttat gcggagaaaa ggatgctcac cgaggtttga      1860
     tggatgcggg caggcctgca ggaaaacagg agctctgagc aagtcatctc tcaggcttcc      1920
     ttctcatgct cactacttcc gccttagctc cagaggacct cgaacccccc tcccccctaa      1980
     cacagtacat ggcatcttgg accaaatatc tggactgtag actgttgctc gatcctcgca      2040
     gcattcgagg tttctccatc ttagtgacat tttggaaatt tcaacggtgc cacccaatca      2100
     tgcccatcag tcacgtggat gagatgcacg tttctgactg atcttccctc aagactgagt      2160
     tttcatgcct gggtcttgta atatctctag gaatggtgac accagtagaa taggaagcag      2220
     ctacactcag gtcccttctt tagtgtcctt tgctttgggt catgcacctt ccttacttag      2280
     cttctggtca cttggtcact ggcagaatct ggagaatgga aaagatttca gcttggcatt      2340
     ttagtgccca agccatcttc tgactggtag agctattagc tgcacggctt tgaaagatat      2400
     ggctaaattt ggatggaatt agagaaaata ctacccaact ggattatttg aaggacatga      2460
     aggtcagttt tagaccaatg ggggccggtg gatttctcta gttgtgatct gtcacaggag      2520
     atgctggcag gggtctacat tagtcctcac cactctgatt ccatgacttc cttgcgcttc      2580
     caggaagaaa cttggcactt cctcagagcc aagttctttt tatgtgcaag cgccttcgtg      2640
     tgcagaggaa ctggaaaata gaactacaga gacaggagaa aaggctgacc agagccaaag      2700
     gactggctgg accacatatc tgaagcaagg tgccacttaa gcagagactg tcacttagaa      2760
     caggcagagg gactctgctg cagacagcag ccaattcctc cagattagct cagacctctt      2820
     taagatatcc tccacccttt ttcctgggaa tctgacctag gattgcaaat ggatttgttt      2880
     ttataaagca acctcagctg taacctacag acaggtgagt tcacacattg aatgccagca      2940
     tagctttcct cttatgccac aggcaacagc ctttggttgg gagccaggga agggcacggt      3000
     cattttgttg gcagcctctc tcttagagga ttttgctgag tcaagcaaac gtttgtctgc      3060
     tcagctcttc ctttggagct gcattgggcc tgctaaggta actcggtcgt tcctacttgg      3120
     accaagccat cttctcccat tgtgaaatca ctgccaccct cccagctgcc cactgccccc      3180
     tcccccagta acattgccat tcagttttgc ctttgataaa ctgtgataca ctcttctcag      3240
     ttctcatggg tacagctctg aaactcaaag gactgttaac atgtttttaa ttttctattg      3300
     atgctttaag actcttcgaa gggaatggct tttcaaaaga tttttttttt ccctgaagaa      3360
     caacttagga aggagtgacc ttgatggttg gcttgagagg ccactgtggc tccactctga      3420
     gttttgccac agctttacag ggtaactctg gtgtcatggt ccctctttgt gcctcagttc      3480
     cccccaccca ttaaatgaga acattaatgt cttcgcctcc ttacctcatg gggaattatc      3540
     aataaactca cccaggaggg tggggaggat gctatgcaaa tgtgtgaatt atagtaatgg      3600
     ccttgagttt tagttcacta tactgcctgc ctatctctca aaggcatggc ctttcctcag      3660
     aactttctac catggatcca aagcctaaga ctaggccatc gtagaccatc agctctctaa      3720
     gtcgctccct gccatcttgg gctgggtctc tccatccttt ctctcacccg tcagaaaagg      3780
     agtgtattct tgcattagac ttggtggcca gaagtcacct tatctgggag cttaacttct      3840
     ccaagcctgc aacatagtaa aaggctgaga tggttgagac tcagagatct attctaaggc      3900
     cagtaagaaa gtactttctg tttccaatga ttttagttac tccatgccca ccccagtggc      3960
     caaagggatg tctccagctg agggtggatg gggggacatg tgtgcatgga cctctgtgta      4020
     tgtatagatt gtcaccctca tcactgtccc tgtccttatg caaacattgc cttttcaagt      4080
     cagagcatgc ctgaaagtaa aaggtttgtg gagagccagg ctctccaggg actctggttg      4140
     ctgtagcaac cttccagact gttctctcta ctgatttggg tatcaaggga gaacagacta      4200
     catatcccag cttctcacac gggaacacct ccaatctatt ggtttaggca ttggcagaac      4260
     taaaataagg actcaggacc tttggcaatg tggagggagt agattcccaa cacttcctgc      4320
     ctagaccttt cttcctggtt ccctgtatgg tcatggaagc cgccacatct tactccgagt      4380
     cttcagaaac ttgaatgctt aaaacctgcc caattcagcc agaagcaagg ttaaggtttt      4440
     caaaggaaga cctcagagag gggtataaaa tgtcccctcc atcgcagcca gactgggcct      4500
     tgaggacaca gatgacacca atctgggatg tcatggtatt ctcatctcag gcgcaggttc      4560
     ttcccagccc taagagagat caagaaggat gaaactcctc cctcccaggg agcaacactg      4620
     ctcctggcaa aattacagaa gtgattctta agatgtcaga cagaaactga gaggctgtga      4680
     ctatcaagtt tttgtggaga attttgtcca gtgagctctc cctgcttctg agcctccatg      4740
     tggatgatgt aaccgtgtca tcaagagacc atgcaccacc ttgtgctgcc tcaacagctg      4800
     gatcaatagg accacagctg ctcaagaagg tggggttcaa gccatctcga tgactgacgt      4860
     aagccagtgg gggctcccag aggatactct gggactgcca atttctgctt gggatgagga      4920
     cagccctcct gcctagcatc ccagaggagc aagggacagc tggcctttct tgcctctgag      4980
     ggttgtgctg cacgaggcca ctctggaaaa cctatgcatc caaagagtac ccgatcttga      5040
     acttctctgg aggatgagac ccccgcctcc ccactgaata actcagccgg acagcccctg      5100
     gtggccttcc acaagcagtg actgagacgg aaggaaaagg aaaaggctga gatggggggg      5160
     ggggctcctt gccagtgaac gatgggattc tgagtgttgg ggtggggcca gaggaggaga      5220
     aggagagttg ctggtctgat caaaggagag gaggtgttag gatgatctgg gatcggaaga      5280
     attcctgagt gtgctgcaga gtcgcccagg cactcgctgg ctgaggaaga gtaactaata      5340
     aataaatgac agtcaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaa             5393
//


spacer
spacer