Dbfetch

ID   BC054766; SV 1; linear; mRNA; STD; MUS; 1693 BP.
XX
AC   BC054766;
XX
DT   05-JUL-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus adipose differentiation related protein, mRNA (cDNA clone
DE   MGC:64802 IMAGE:6414796), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1693
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1693
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUL-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4a9d06ae86051a50e3be5d752686e658.
DR   Ensembl-Gn; ENSMUSG00000028494; mus_musculus.
DR   Ensembl-Gn; MGP_DBA2J_G0028227; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027273; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000000466; mus_musculus.
DR   Ensembl-Tr; MGP_DBA2J_T0065955; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065771; mus_musculus_pwkphj.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982515.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1693
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FR0"
FT                   /clone="MGC:64802 IMAGE:6414796"
FT                   /tissue_type="Brain, pool of enriched mouse brain tissues
FT                   from 13.5,14.5,16.5 and 17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1693
FT                   /gene="Adfp"
FT                   /note="synonym: ADPH"
FT   CDS             55..1332
FT                   /codon_start=1
FT                   /gene="Adfp"
FT                   /product="adipose differentiation related protein"
FT                   /db_xref="GOA:P43883"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:87920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43883"
FT                   /protein_id="AAH54766.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLS
FT                   TKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYV
FT                   SWVEWKRSIGYDDTDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQ
FT                   AKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWL
FT                   VGPFYPQSTEVNKASLKVQQSEVKAQ"
FT   misc_difference 1660..1693
FT                   /gene="Adfp"
FT                   /note="polyA tail: 34 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1693 BP; 451 A; 412 C; 449 G; 381 T; 0 other;
     cttgctcgtc cctcagctct cctgttaggc gtctcttttc tccaggagga aaaaatggca        60
     gcagcagtag tggatccgca acagagcgtg gtgatgagag tggccaacct gcccttggtg       120
     agctctacct acgaccttgt gtcctccgct tatgtcagta caaaggatca gtacccgtat       180
     ttgagatccg tgtgtgagat ggccgagaag ggcgtgaaga ccgtgacctc tgcggccatg       240
     acaagtgccc tgcccatcat ccagaagctg gagccacaaa ttgcggttgc caatacctat       300
     gcctgcaagg ggctagacag gatggaggaa agactgccta ttctgaacca gccaacgtcc       360
     gagattgttg ccagtgccag aggtgccgta actggggcga aggatgtggt gacgactacc       420
     atggctggag ccaaggattc tgtagccagc acagtctcag gggtggtgga taagaccaaa       480
     ggagcagtga ctggcagcgt ggaaaggacc aagtctgtgg tcaatggcag catcaataca       540
     gttttgggga tggtgcagtt catgaacagt ggagtagata atgccatcac caagtcggag       600
     ctgctggtag accagtactt ccctctcact caggaggagc tggagatgga agcaaaaaag       660
     gtggaaggat ttgatatggt tcagaagccg agcaactatg aacggctgga gtccctgtct       720
     accaagctct gctctcgggc ttatcaccag gctctcagca gggttaaaga ggccaaacaa       780
     aagagccagg agaccatttc tcagctccac tccactgtcc acctgattga attcgccagg       840
     aagaatatgc acagtgccaa ccagaaaatt cagggtgctc aggataagct ctatgtctcg       900
     tgggtggagt ggaagagaag catcggctac gacgacaccg atgagtccca ctgtgttgag       960
     cacatcgagt cacgtactct ggctatcgcc cgcaacctga cccagcagct ccagactaca      1020
     tgccagactg tcctggtcaa cgcccaaggg ttaccacaga acattcaaga tcaggccaaa      1080
     cacttggggg tgatggcagg cgacatctac tccgtattcc gcaatgctgc ctcctttaag      1140
     gaagtgtccg atggcgtcct cacatctagc aaggggcagc tgcagaaaat gaaggaatcc      1200
     ttagatgaag ttatggatta ctttgttaac aacacgcctc tcaactggct ggtaggtccc      1260
     ttttatcctc agtctaccga ggtgaacaag gccagcctga aggtccagca gtctgaggtc      1320
     aaagctcagt aaacccctcc ttgtcaccag agcatgatgt tgctggccag atgacccctt      1380
     ttgctgtatt gaaattaact tggtagatgg ctttagctta gaaaagcagc ttcttagaac      1440
     caagggcctc attatggtca ctcacagctc agttatggtc ttgccccagc tggccctggc      1500
     acaggagttc tcttacctgg ctggtgagtg gcctgtgtta gtcttgtgag gacctcgagg      1560
     aacctaaaag ctcagatgca cttacagtct tgtctgtggc ctttgtattg ttattggctg      1620
     taaacgtctg tctggaccga ataaagattc attcacgtga aaaaaaaaaa aaaaaaaaaa      1680
     aaaaaaaaaa aaa                                                         1693
//