spacer

EBI Dbfetch

ID   BC054759; SV 1; linear; mRNA; STD; MUS; 2296 BP.
XX
AC   BC054759;
XX
DT   05-JUL-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus CD200 antigen, mRNA (cDNA clone MGC:64783 IMAGE:6413363),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2296
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2296
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUL-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e577d1f0eb8b4d29b3394527b5ec9807.
DR   Ensembl-Gn; ENSMUSG00000022661; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163230; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAV Plate: 128 Row: a Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543262.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2296
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FR0"
FT                   /clone="MGC:64783 IMAGE:6413363"
FT                   /tissue_type="Brain, pool of enriched mouse brain tissues
FT                   from 13.5,14.5,16.5 and 17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2296
FT                   /gene="Cd200"
FT                   /note="synonym: OX2"
FT   CDS             120..956
FT                   /codon_start=1
FT                   /gene="Cd200"
FT                   /product="CD200 antigen"
FT                   /db_xref="GOA:Q80VX2"
FT                   /db_xref="InterPro:IPR003596"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1196990"
FT                   /db_xref="UniProtKB/TrEMBL:Q80VX2"
FT                   /protein_id="AAH54759.1"
FT                   /translation="MGSLVFRRPFCHLSTYSLIWGMAAVALSTAQVEVVTQDERKALHT
FT                   TASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNS
FT                   SITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSAT
FT                   ARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNV
FT                   IDYKQSLDKGFWFSVPLLLSIVSLVILLILISILLYWKRHRNQERGESSQGMQRMK"
FT   misc_difference 2281..2296
FT                   /gene="Cd200"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2296 BP; 639 A; 503 C; 500 G; 654 T; 0 other;
     gggggctctc tctacggcga atagtagtgt ccctgctcac aggtgttgcg gagatatcct        60
     ccatcgtgga agagctcaga ccccgagaag ctggtgtcta gctgcggccc agagcaagga       120
     tgggcagtct ggtattcagg agacctttct gccatctctc cacctacagc ctgatttggg       180
     gcatggcagc agtagcgctg agcacagctc aagtggaagt ggtgacccag gatgaaagaa       240
     aggcgctgca cacaactgca tccttacgat gttctctaaa aacatcccag gaacccttga       300
     ttgtgacatg gcagaaaaag aaagccgtga gcccagaaaa catggtcacc tacagcaaaa       360
     cccatggggt tgtaatccag cctgcctaca aagacaggat aaatgtcaca gagctgggac       420
     tctggaactc aagcatcacc ttctggaaca caacattgga agatgagggc tgctacatgt       480
     gtctcttcaa cacgtttggt tctcagaagg tctcaggaac agcttgcctt accctctatg       540
     tacagcccat agtacacctt cactacaact attttgaaga ccacctaaac atcacttgct       600
     ctgcgactgc ccgtccagcc cctgccatct cctggaaggg tactgggaca ggaattgaga       660
     atagtaccga gagtcacttc cattcaaatg ggactacatc tgtcaccagc atcctccggg       720
     tcaaagaccc caaaactcaa gttgggaagg aagtgatctg ccaggtttta tacctgggga       780
     atgtgattga ctacaagcag agtctggaca aaggattttg gttttcagtt ccactgttgc       840
     taagcattgt ttctctggta attcttctga tcttgatctc catcttacta tactggaaac       900
     gtcaccgaaa tcaggagcgg ggtgaatcat cacaggggat gcaaagaatg aaataagagc       960
     tctaaagaaa ttatacagaa ccctgaacgt gtttccctgg tctacttgaa tctgatgtga      1020
     aagaaaagca ggagggaaaa ggccattctc cataggacct aaggagagca aaagaccaga      1080
     cacgagcctg tgagggattt gactttttgc tgttgtccca ggtcctcggt gtttgcattc      1140
     caagaggaag tcgagtgcct cgggtctgtt gtaggacttg attttttttt tttttgtaga      1200
     gcaatgcagt gccatgctgt tagaaaggct ccagacttag aaccaccagt gccaagccag      1260
     ctctcagacc gactagggct cccatcggag gaacaaatcg tagtcaactt acctcacaga      1320
     gctctctggt ccttacacaa agtagaaagg agtgggacca gaaaattggc catgtctgaa      1380
     atctgatgga atttttagga agaaaactga agaataagca aaagaagaaa gaacacagaa      1440
     gggtccaaag agcttctgag agtacctttt gcctttctgt tggtgtccca gctctggttt      1500
     tgttcttagg tccgccagtg tgtttccctg ttgtttgagt atctagttga ctacctgcta      1560
     ctgttctgct gatggttggc cttgctagaa tccctgactc ccctgccgtt ctctatgtgc      1620
     ttctatgagg gttactatga tgaaaataga gcagaagata gtgtgaagta acattggcaa      1680
     ctgtaatgtg tccatttaac ttatttttat agcacttagg caatattgtt agtcttagtg      1740
     agtagttcac atctttacaa aagcatgctc tccctatcca ttgggcccac aataacactc      1800
     tctttgaggc cattctgaat cctgtctcgt gtaatgataa tatattatga aaacagatac      1860
     tttaagaatt tcctgtacag cagtcagttg tttattctct ctctctctct ctctctctct      1920
     ctccctcccc caccccagct tctttttctg tgactttgtt tttcataaag agaaggcatc      1980
     tcctgaatac aatcgctttg ttctgaagac atcgtgaact attaattctt aaccctttga      2040
     caaaactagt gaagttgttt tctgtatctt ttgcttcatc tgtctttata gagtgaccta      2100
     ggaattcaag tgtaagttgt ttccattgtt gaactggata tttatatact tggtatgctt      2160
     ttcacgtgtt atttaattct gtataatttc ctatatttgt attaaaatat tgagcaatta      2220
     aaagtgtcaa ctaaatattt gatgtggcat tcccttgaga aatatagaaa taaagaataa      2280
     aaaaaaaaaa aaaaaa                                                      2296
//


spacer
spacer