spacer

EBI Dbfetch

ID   BC054755; SV 1; linear; mRNA; STD; MUS; 1281 BP.
XX
AC   BC054755;
XX
DT   05-JUL-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus nucleophosmin 1, mRNA (cDNA clone MGC:64789 IMAGE:6411700),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1281
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1281
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUL-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e3a11c69a504f9fa163fcc403baca712.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
DR   EuropePMC; PMC3190308; 20802533.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6679107.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1281
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FP0"
FT                   /clone="MGC:64789 IMAGE:6411700"
FT                   /tissue_type="Brain, enriched mouse brain 15dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1281
FT                   /gene="Npm1"
FT                   /note="synonyms: B23, NO38"
FT   CDS             81..959
FT                   /codon_start=1
FT                   /gene="Npm1"
FT                   /product="nucleophosmin 1"
FT                   /db_xref="GOA:Q61937"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="PDB:4N8M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61937"
FT                   /protein_id="AAH54755.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
FT   misc_difference 1264..1281
FT                   /gene="Npm1"
FT                   /note="polyA tail: 18 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1281 BP; 438 A; 216 C; 305 G; 322 T; 0 other;
     cctgcgcgtc tgttctgtgg aacaggaggc agttgttttc cgtccggctt ctcccacacc        60
     gaagtgcgcg cctccacctc atggaagact cgatggatat ggacatgagt cctcttaggc       120
     ctcagaacta ccttttcggc tgtgaactaa aggctgacaa agactatcac tttaaagtgg       180
     ataatgatga aaatgagcac cagttgtcat taagaacggt cagtttagga gcaggggcaa       240
     aagatgagtt acacatcgta gaggcagaag caatgaacta tgaaggcagt ccaattaaag       300
     taacactggc aactttgaaa atgtctgtac aaccaacagt ttccctaggg ggctttgaaa       360
     ttacaccacc tgtggtctta cggttgaagt gtggttcagg gcctgtgcac attagtggac       420
     agcatctagt agctgtagag gaagatgcag agtctgaaga tgaagatgag gaggacgtaa       480
     aactcttagg catgtctgga aagcgatctg ctcctggagg tggtaacaag gttccacaga       540
     aaaaagtaaa acttgatgaa gatgatgagg acgatgatga ggacgatgag gatgatgagg       600
     atgatgatga tgatgatttt gatgaagagg aaactgaaga aaaggtccca gtgaagaaat       660
     ctgtacgaga taccccagcc aaaaatgcac aaaaatcaaa ccaaaatgga aaagacttaa       720
     aaccatcaac accgagatca aagggtcaag agtccttcaa aaaacaggaa aagactccta       780
     aaacaccaaa aggacctagt tctgtagaag acattaaggc aaaaatgcaa gcaagtatag       840
     aaaaaggcgg ttctcttccc aaagtggaag ccaagttcat taattatgtg aagaattgtt       900
     tccggatgac tgaccaggag gctattcaag atctctggca gtggaggaaa tctctttaag       960
     aaaagggttt aaacagtttg aaatattctg tcttcatttc tgtaatagtt aatatctggc      1020
     tgtccttttt ataatgcaaa gtgagaactt tccctactgt gtttgataaa tgttgtccag      1080
     gttcacttgc caagaatgtg ttgtctaaaa tgcctgttta gttttcaagg atggaactcc      1140
     accctttact tggttttaag tatgtatgga atgttatgat aggacatagt aatagtggtc      1200
     agatgtggaa atggtaggga gacaaatata catgtgaaat aaactcagta ttttaataaa      1260
     gtaaaaaaaa aaaaaaaaaa a                                                1281
//


spacer
spacer