spacer

EBI Dbfetch

ID   BC054735; SV 1; linear; mRNA; STD; MUS; 3361 BP.
XX
AC   BC054735;
XX
DT   05-JUL-2003 (Rel. 76, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus gamma-aminobutyric acid (GABA-B) receptor, 1, mRNA (cDNA clone
DE   MGC:65639 IMAGE:6401243), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3361
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3361
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUL-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7d849f2bd6bddf1e6826d46384bf175e.
DR   Ensembl-Gn; ENSMUSG00000024462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172792; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3361
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FC0"
FT                   /clone="MGC:65639 IMAGE:6401243"
FT                   /tissue_type="Mouse, brain 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..3361
FT                   /gene="Gabbr1"
FT                   /note="synonyms: GABAbR1, bM573K1.1"
FT   CDS             325..3207
FT                   /codon_start=1
FT                   /gene="Gabbr1"
FT                   /product="Gabbr1 protein"
FT                   /db_xref="GOA:Q9WV18"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR002455"
FT                   /db_xref="InterPro:IPR002456"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1860139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV18"
FT                   /protein_id="AAH54735.1"
FT                   /translation="MLLLLLVPLFLRPLGAGGAQTPNVTSEGCQIIHPPWEGGIRYRGL
FT                   TRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYL
FT                   TLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPH
FT                   SERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPG
FT                   QATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPT
FT                   FFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQ
FT                   SFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNW
FT                   FKTYDPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPE
FT                   ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSF
FT                   EGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQ
FT                   TLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVG
FT                   CSLALAAVFPLGLDGYHIGRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKK
FT                   EEKKEWRKTLEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSI
FT                   LPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVA
FT                   VLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQD
FT                   TMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQIRSRRHPPTP
FT                   PDPSGGLPRGPSEPPDRLSCDGSRVHLLYK"
FT   misc_difference 3331..3361
FT                   /gene="Gabbr1"
FT                   /note="polyA tail: 31 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3361 BP; 762 A; 945 C; 946 G; 708 T; 0 other;
     ccctcccttc cccccgcccc gtcttcccct gcaccctcct tcctccctcc gcccgagagc        60
     ttccccggtc cccggcgccg cctccttccc tcccggcacc gtgctctcgc ggccgccgtc       120
     gccccgggga aggagagacg ggggtggggt ttgcgggtag cgatcgcgaa ggggagagac       180
     cccggccggg ctggagcctg gattcctgtg gaagaagaac agggggaggg gaagctggag       240
     gaccgggagg gagaacgggg agccgcggcc gggcctgggc ccttgaggcc cggggagagc       300
     cgcggagcgg gaccggccgc cgagatgctg ctgctgctgc tggtgcctct cttcctccgc       360
     cccctgggcg ctggcggggc tcagaccccc aacgtcacct cggaaggttg ccagattata       420
     catccgccct gggaaggtgg catcaggtac cgtggcttga ctcgcgacca ggtgaaggcc       480
     atcaatttcc tgcctgtgga ctatgagatt gaatatgtgt gccggggcga acgcgaggtg       540
     gtggggccca aggtgcgcaa gtgcctggcc aacggctcct ggacggatat ggacacaccc       600
     agtcgctgtg tccgaatctg ctccaagtct tatttgaccc tggaaaatgg gaaggttttc       660
     ctgacgggtg gggacctccc agctctggat ggagcccggg tggatttccg atgtgacccc       720
     gacttccatc tggtgggcag ctcccggagc atctgtagtc agggccagtg gagcaccccc       780
     aagccccact gccaggtgaa tcgaacgcca cactcagaac ggcgtgcagt atacatcggg       840
     gcgctgtttc ccatgagcgg gggctggccg gggggccagg cctgccagcc tgcggtggag       900
     atggcgctgg aggacgttaa cagccgcaga gacatcctgc cggactacga gctcaagctt       960
     atccaccacg acagcaagtg cgacccaggg caagccacca agtacttgta tgaactactc      1020
     tacaacgacc ccatcaagat catcctcatg cccggctgca gctctgtgtc cacactggta      1080
     gccgaggctg cccggatgtg gaaccttatt gtgctctcat atggctccag ctcaccagcc      1140
     ttgtcaaacc gacagcggtt tccaacgttc tttcggacac atccatccgc cacactccac      1200
     aatcccaccc gggtgaaact cttcgaaaag tggggctgga agaagattgc caccatccag      1260
     cagactaccg aggtcttcac ctcaacactg gatgacctgg aggagcgagt gaaagaggct      1320
     gggattgaga tcacttttcg acagagtttc ttctcagatc cagctgtgcc tgttaaaaac      1380
     ctgaagcgtc aagatgctcg aatcatcgtg ggacttttct atgagaccga agcccggaaa      1440
     gttttttgtg aggtctataa ggaacggctc tttgggaaga agtatgtctg gtttctcatc      1500
     gggtggtatg ctgacaactg gttcaaaacc tatgacccgt caatcaattg tacagtagaa      1560
     gagatgactg aggcggtgga gggccatatc accacggaga ttgtcatgct gaaccctgcc      1620
     aacacccgaa gcatttccaa catgacatca caggaatttg tggagaaact aaccaagcgg      1680
     ctgaaaagac accctgagga gactggaggc ttccaggagg caccactggc ctatgatgct      1740
     atctgggcct tggctttggc cttgaacaag acctctggag gaggtggccg ttcaggagtg      1800
     cgcctggagg actttaacta caacaaccag accattacag accaaatcta ccgggccatg      1860
     aactcctcct cctttgaggg tgtttctggc cacgtggtct ttgatgccag cggctcccgg      1920
     atggcatgga cgcttatcga gcagctacag ggcggcagct acaagaagat cggctactac      1980
     gacagcacca aggatgatct ttcctggtcc aaaacagaca agtggatcgg agggtctccc      2040
     ccagccgacc agaccttggt catcaagaca ttccgtttcc tgtcacagaa actctttatc      2100
     tccgtctcag ttctctccag cctgggcatt gttcttgctg ttgtctgtct gtcctttaac      2160
     atctacaact cccacgttcg ttatatccag aactcccagc ccaacctgaa caatctgact      2220
     gctgtgggct gctcactggc actagctgct gtcttccccc ttgggctgga tggttaccac      2280
     atagggagaa gccagttccc atttgtctgc caggcccgcc tttggctctt gggcttaggc      2340
     tttagtctgg gctatggctc tatgttcacc aagatctggt gggtccacac agtcttcaca      2400
     aagaaggagg agaagaagga atggaggaag accctagagc cttggaaact gtacgccact      2460
     gtaggcctgc tggtgggcat ggatatcctg actcttgcca tctggcagat tgtggacccc      2520
     ttgcaccgaa ccattgagac ttttgccaag gaggaaccaa aggaagacat tgatgtctcc      2580
     attctgcccc agctggagca ctgcagctcc aagaagatga atacatggct cggcattttc      2640
     tatggttaca aagggctgct gctgctgctg ggaatctttc ttgcttatga gaccaaaagt      2700
     gtgtccactg aaaagatcaa tgaccacagg gccgtgggca tggctatcta caatgttgcg      2760
     gtcctgtgtc tcattaccgc tcctgtcacc atgatccttt ccagccagca ggacgcagcc      2820
     ttcgcctttg cctctctggc cattgtgttc tcttcctaca ttactctggt tgtgctcttt      2880
     gtgcctaaga tgcgcaggtt gatcactcga ggtgaatggc agtctgaagc acaggacaca      2940
     atgaaaacag gatcatccac caacaacaat gaggaagaga agtcccgact gttggagaag      3000
     gaaaaccgtg aattggaaaa gatcatcgcc gagaaagagg agcgtgtctc tgaactgcgc      3060
     catcagctcc agtctcggca gcagatccgc tcccggcgcc accccccaac acccccagac      3120
     ccctctgggg gccttcccag gggaccctca gagccccctg accggcttag ctgtgatggg      3180
     agtcgagtac atttgcttta caagtgaggg tgtatcgaga aggatgaggc cagcagggga      3240
     gggaagggtg tggggagtgg gtggggaact gggaagaggg tggagaacaa gctccaatcc      3300
     ccctcttaga aatacatgtc attctgtgca aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3360
     a                                                                      3361
//


spacer
spacer