spacer

EBI Dbfetch

ID   BC054473; SV 1; linear; mRNA; STD; MUS; 1313 BP.
XX
AC   BC054473;
XX
DT   04-JUL-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus insulin-like growth factor binding protein 2, mRNA (cDNA clone
DE   MGC:62643 IMAGE:6488878), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1313
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1313
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-JUN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9887a31d0d8878b3e29ec3059e34af67.
DR   Ensembl-Gn; ENSMUSG00000039323; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047328; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 116 Row: j Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982259.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1313
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="MGC:62643 IMAGE:6488878"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1313
FT                   /gene="Igfbp2"
FT   CDS             74..991
FT                   /codon_start=1
FT                   /gene="Igfbp2"
FT                   /product="insulin-like growth factor binding protein 2"
FT                   /db_xref="GOA:P47877"
FT                   /db_xref="InterPro:IPR000716"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR009168"
FT                   /db_xref="InterPro:IPR012210"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="InterPro:IPR022321"
FT                   /db_xref="MGI:MGI:96437"
FT                   /protein_id="AAH54473.1"
FT                   /translation="MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTP
FT                   ERLAACGPPPDAPCAELVREPGCGCCSVCARQEGEACGVYIPRCAQTLRCYPNPGSELP
FT                   LKALVTGAGTCEKRRVGTTPQQVADSDDDHSEGGLVENHVDGTMNMLGGGSSAGRKPLK
FT                   SGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPARTPCQQELDQVLERISTMR
FT                   LPDDRGPLEHLYSLHIPNCDKHGRYNLKQCKMSLNGQRGECWCVNPNTGKPIQGAPTIR
FT                   GDPECHLFYNEQQETGGAHAQSVQ"
FT   misc_difference 1304..1313
FT                   /gene="Igfbp2"
FT                   /note="polyA tail: 10 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1313 BP; 270 A; 403 C; 406 G; 234 T; 0 other;
     gcgtctcccg cattcgtctg ggccgtgcca cctgcccgct agctcgctgc actaccgttg        60
     cccacaagcc aacatgctgc cgagattggg cggccccgcg ctgccgctgc tcctgccgtc       120
     gttgctcttg ctgctgctct tgggcgcggg cggctgcggc cccggggtgc gcgccgaggt       180
     gctgttccgc tgcccaccct gcacgcccga gcgtctggcc gcttgcgggc ccccacccga       240
     cgcgccctgc gccgagctgg tgcgagagcc cggctgcggc tgctgctccg tgtgcgcacg       300
     gcaggagggc gaagcatgcg gcgtctacat cccgcgctgc gcccagacgc tacgctgcta       360
     tcccaacccg ggctccgagc tgcccctgaa ggcgcttgtc acaggcgcgg gtacctgtga       420
     aaagagacgc gtgggcacca ccccacagca ggttgcagac agtgatgacg accactctga       480
     gggaggcctg gtggagaacc acgtggatgg gaccatgaac atgttgggag gtggtagcag       540
     tgctggccgg aagcccctca agtcaggcat gaaggagctg gctgtgttcc gggagaaggt       600
     caatgaacag caccggcaga tgggcaaggg tgccaaacac ctcagtctgg aggagcccaa       660
     gaagttgcgc ccgcctcccg ccaggacccc ttgccagcag gagttggacc aggtcctgga       720
     gcggatctcc accatgcgcc ttccggatga tcggggcccc ctggaacatc tctactccct       780
     gcacatcccc aactgtgaca agcatggccg gtacaacctt aagcagtgca agatgtctct       840
     gaacggacag cgcggggagt gctggtgtgt gaaccccaat accgggaagc ccatccaggg       900
     agctcccacc atccggggag accccgagtg ccatctcttc tacaacgagc agcaggagac       960
     tggtggggcc catgcccaaa gtgtgcagta aaccccagcc agtcggtgcc tggcttcccc      1020
     atcccgaaca ccagcagaaa tggagggcgt cagggtgacg ggtgtggagg agttcccagt      1080
     tttgacacat gtatttatat ttggaaagag accaacactg agctcagaag cccccctctg      1140
     acccccccca gcggctgtta agctgaacct cccttgcttc tgttagagag gggaagggtg      1200
     gtatggaggg cactgggtac aggcctggga atggggaaag aaatttttat ttttgaatcc      1260
     ctgtgtctct tttacttaag attaaaggaa ggaaaaataa aaaaaaaaaa aaa             1313
//


spacer
spacer