spacer

EBI Dbfetch

ID   BC054462; SV 1; linear; mRNA; STD; MUS; 2799 BP.
XX
AC   BC054462;
XX
DT   04-JUL-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus solute carrier family 17 (sodium-dependent inorganic phosphate
DE   cotransporter), member 7, mRNA (cDNA clone MGC:62859 IMAGE:6494471),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2799
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2799
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-JUN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cbac51f2df7da04c57d1a38ec7054a93.
DR   Ensembl-Gn; ENSMUSG00000070570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085374; mus_musculus.
DR   EuropePMC; PMC3828467; 24227725.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 116 Row: m Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 33859826.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2799
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:62859 IMAGE:6494471"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2799
FT                   /gene="Slc17a7"
FT                   /note="synonym: Vglut1"
FT   CDS             419..1627
FT                   /codon_start=1
FT                   /gene="Slc17a7"
FT                   /product="solute carrier family 17 (sodium-dependent
FT                   inorganic phosphate cotransporter), member 7"
FT                   /db_xref="GOA:Q7TQH3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1920211"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQH3"
FT                   /protein_id="AAH54462.1"
FT                   /translation="MLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLER
FT                   SRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPAL
FT                   HPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLL
FT                   LISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLM
FT                   NCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMG
FT                   ISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWA
FT                   EPEEMSEEKCGFVGHDQLAGSDESEMEDEAEPPGAPPAPPPSYGATHSTVQPPRPPPPV
FT                   RDY"
FT   misc_difference 2723..2799
FT                   /gene="Slc17a7"
FT                   /note="polyA tail: 77 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2799 BP; 585 A; 782 C; 742 G; 690 T; 0 other;
     tggggatatt cagggagggg atactgaggt aagcaagcaa gtagaactga gcttctaggc        60
     agcagcgcct gtagctaaag tggtagggca ggccctagca acatagaagg gtggagctcc       120
     actgagctct gattggtaga tttgggcaga gggcggggca tcttgttgct gattggctaa       180
     ggagctaagt ctatgggtgc tgattggtag agggtagagt ctggggggca tctagtttga       240
     tgtgtatttt gacccacaga aagcccagtt caactgggat ccagagactg tcggcctcat       300
     acatggctcc tttttctggg gctacattgt cactcagatt cctggaggat ttatctgcca       360
     aaaattcgca gccaacaggg tctttggctt tgccattgtg gctacctcca ccctaaacat       420
     gttgatccct tcagcagccc gcgttcacta tggctgtgtc atcttcgtga ggatccttca       480
     gggattggtg gagggggtca cataccctgc ttgccatggc atctggagca aatgggcccc       540
     tcccttagaa cggagtcggc tggcaacgac agccttttgc ggttcctatg ctggggcggt       600
     ggttgccatg cccttggctg gggtccttgt gcagtattca ggatggagtt ctgtcttcta       660
     tgtctatggc agcttcggga tcttttggta cctgttctgg ttgcttgtct cctatgagtc       720
     accggcactg caccccagca tctctgagga ggagcgcaaa tacattgagg atgccatcgg       780
     ggagagcgcc aagctcatga accctgttac gaagtttaac acaccctgga ggcgcttctt       840
     tacgtccatg cccgtctatg ccatcatcgt tgcgaacttt tgccgcagct ggaccttcta       900
     cctgctcctc atctctcagc ccgcctactt tgaagaagtg ttcggctttg agatcagcaa       960
     ggtggggctg gtgtcggcgc tgcctcacct tgtcatgacc atcatcgtac ccattggagg      1020
     ccagatcgct gactttttgc gcagtcgtca cataatgtcc actaccaacg tgcgaaagct      1080
     catgaactgc gggggtttcg ggatggaagc cacgctgctg ctggtggtcg gatactcgca      1140
     ctccaagggc gtggccatct ccttcctggt cctggctgtg ggcttcagtg gctttgccat      1200
     ctctgggttt aacgtgaacc acttggacat cgcccctcgc tatgccagca tcttgatggg      1260
     catttccaat ggcgtgggca cactgtctgg gatggtgtgc cccatcatcg tgggtgcaat      1320
     gaccaagcac aagacgcggg aggagtggca gtacgtgttc ctcatagcct ccctggtgca      1380
     ctacggcggt gtcatcttct atggggtctt tgcttcggga gagaagcagc cgtgggcaga      1440
     gccggaggag atgagcgagg agaagtgtgg ctttgttggc cacgaccagc tggctggcag      1500
     tgacgaaagt gaaatggagg acgaggctga gcccccaggg gcgccccccg cgccgcctcc      1560
     gtcctacggg gccacacaca gcacagtgca gcctccgagg cccccgcccc ctgtccggga      1620
     ctactgacca cgggcctccc actgtggggc agtttccagg acttccactc catacacctc      1680
     tagcctgagc ggcagtgtcg aggaacccca ctcctcccct gcctcaggct taagatgcaa      1740
     gtcctccctt gttcccagtg ctgtccgacc agccctcttt ccctctcaac tgcctcctgc      1800
     ggggggtgaa gctgcacact agcagtttca aggataccca gactcccctg aaagtcgttc      1860
     tccgcttgtt tctgcctgtg tgggctcaaa tctccccttt gagggcttta tttggaggga      1920
     cagttcaacc tcttcctctc ttgtggtttt gaggtttcac cccttccccc aagaccccag      1980
     ggattctcag gctaccccga gattattcag gtggtcccct actcagaaga cttcatggtc      2040
     gtcctctatt agtttcaagg ctcgcctaac caattctaca tttttccaag ctggtttaac      2100
     ctaaccacca atgccgccgt tcccaggact gattctcacc agcgtttctg agggaaaatg      2160
     gcggtttcaa gtccccccac cccccttttc ttccctcgtc ccctcaccag cacactttgc      2220
     cgggccttga ccttagctta gtacaatcat tgtccaggga aatggccaaa atggctctgc      2280
     tcaccccgtg ctctttttct gactcagttt tcaggtctca gtagtggctg cccaaagcta      2340
     ttaattcagc ggctcgaggc cacctcttcc tccccgtggt ggtttcagga tccccctcgc      2400
     cccccccccc ccaaatcctt gcactttatt ctcctgggtg gttccaggcc gccctcggtt      2460
     tctcagtggc catttgttgt gtgtccctca ggggctaaat gattccaaat ctggggtgct      2520
     tcccctcata gacacccctc tctcaacgta gaaatctggg tgggggtgag gtgtgtgaga      2580
     gaagttacag aatcccagga aagggagcgg ggctgggagg agagggttgt tcctggggca      2640
     gggtcgtgtc ttggtgtctg tctctgtgac gtaaatcctg ccctgcccca ccccactccc      2700
     aataaacgct ctggtgtacg gaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2760
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                             2799
//


spacer
spacer