Dbfetch

ID   BC054366; SV 1; linear; mRNA; STD; MUS; 2053 BP.
XX
AC   BC054366;
XX
DT   04-JUL-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus adenylate kinase 1, mRNA (cDNA clone MGC:62584 IMAGE:5346232),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2053
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2053
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-JUN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 05e8c3c0f9595bb5baa70ee7311abdf1.
DR   Ensembl-Gn; ENSMUSG00000026817; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113277; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113278; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 116 Row: e Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 10946935.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2053
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:62584 IMAGE:5346232"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2053
FT                   /gene="Ak1"
FT   CDS             52..684
FT                   /codon_start=1
FT                   /gene="Ak1"
FT                   /product="adenylate kinase 1"
FT                   /db_xref="GOA:Q9R0Y5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028582"
FT                   /db_xref="MGI:MGI:87977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0Y5"
FT                   /protein_id="AAH54366.1"
FT                   /translation="MGCCVSSEPQEEGGRKTGEKLKKAKIIFVVGGPGSGKGTQCEKIV
FT                   QKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSN
FT                   GFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIK
FT                   KRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK"
FT   misc_difference 1187
FT                   /gene="Ak1"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2034..2053
FT                   /gene="Ak1"
FT                   /note="polyA tail: 20 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2053 BP; 441 A; 540 C; 569 G; 503 T; 0 other;
     cagggccaaa gccagagaga ggggaggtga cagcgggaac aggataggat catgggctgc        60
     tgtgtgtcta gtgaacccca agaagaggga ggcagaaaga ctggagagaa gctgaagaag       120
     gccaagatca tctttgtggt gggcggacct ggctcaggaa agggcaccca gtgcgagaag       180
     attgtacaga aatatggcta cacccacctg tctactgggg acctgcttcg ggcagaagtc       240
     agctctggat cggagagggg caagaagctg tcggctatca tggagaaggg agagctagtg       300
     ccactggaca cggtgctgga catgctccga gatgctatgt tagccaaagt ggattcttcc       360
     aatggcttcc tgatcgacgg ctacccgagg gaggtgaaac agggagaaga atttgaacag       420
     aagattggac agcccacact gctgctgtat gtggacgcag gcgccgagac catgacccaa       480
     cgactcctga agcgagggga gaccagtggc cgcgtggatg acaacgagga gaccatcaag       540
     aagcggctgg agacttatta caatgccaca gaacctgtca tctccttcta tgacaagcgt       600
     ggcattgtgc gcaaggtcaa tgccgaaggc acggtggaca ctgtcttctc tgaggtctgc       660
     acctatcttg actccctgaa gtaactggat cccttggcca gctcccagcc cgccccaccc       720
     ttgctccctg accccaggca gcctggctca agcccagcac ctccaccctg ccgggctgtg       780
     cacagacaca ggaagccatg ttatcctgtc ccatggacac taaagaaatt gccaaggagg       840
     gttaggattg ctcctttcct ttgcttccag ttatggtgat tcatgctgcc acagccggag       900
     gccccagcgt ggccggccca ttcttccctg tgcctcagcc cagctgtctt gtctccctct       960
     ggctctgctg ggatcctagg cccttcctta gccaggctgt gtcaaagcct aggggtccct      1020
     gggttggcag gctgctctgg ggggtctggt gttcaccctg tttctcatag cctcgttgtg      1080
     tggctttggc cctaagccat tgtctctctg gagtgagttt tctttttttc tttctttctt      1140
     tttctttttt ttctttctct gtttctttct tttttttttt ttttaacaca gcatctcgtg      1200
     tgacttaagc tggcctcaac cctgttatgt aactaagggc aaccttaatc cttctgcctc      1260
     cacttgtctt cctgtgtgct gagattacag gtgtgtgtgt ggacctccac cactcctggt      1320
     tttgggggca ctgggaatca agcccatggc cctgtatacg aggccagcac gctacagagt      1380
     gagctgcatc ccgggctggg caggttttct gtgcctgact ggggtctggc atgggcaaag      1440
     ggcaaagggc catgggctca ccagctgggg ccacgtggtc actgggtgcc aaggagctgt      1500
     gcaatgggca tacagctagg tgggaagctg gggtcagggg tggccttcct gaagaaggct      1560
     cccttggtat agacctgcca ggccttgcca tcctttggct ggttttaaag cttgtcctgt      1620
     cacgctatgt cccaaccctt atcctcggcg ttaagacaag agcatgcaga ttaaggagtg      1680
     tgagctgcca tagacaagga tgtgggatca aggaccaggc ctgggacccg gagaggacac      1740
     ccagggatgc caagaagagc tggcatctct cttctgctct ttattctttg gtctcattac      1800
     acaggaagcc tctgttggta ctcacttgtc ctggggcccc gtctccatcc ctagtgactt      1860
     cccctgtaag cccagatagc ctgtaagcca gcagccatgg ctgtcccagg gacacctgcc      1920
     cctgggggtg acggtgctca ctcctttctg tttactacca gtggggccac ctttccttct      1980
     gcattgccta tttaagctgt cctttaaaat aaataaatgt atttcagtta taaaaaaaaa      2040
     aaaaaaaaaa aaa                                                         2053
//