spacer

EBI Dbfetch

ID   BC053028; SV 1; linear; mRNA; STD; MUS; 5167 BP.
XX
AC   BC053028;
XX
DT   06-JUN-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus large tumor suppressor 2, mRNA (cDNA clone MGC:62249
DE   IMAGE:6409832), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5167
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-5167
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JUN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; df06b386192e22d8c2ca4a4342cb3e74.
DR   Ensembl-Gn; ENSMUSG00000021959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022531; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 114 Row: p Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 7657294.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5167
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FO0"
FT                   /clone="MGC:62249 IMAGE:6409832"
FT                   /tissue_type="Brain, enriched mouse brain 12.5dp"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..5167
FT                   /gene="Lats2"
FT   CDS             391..3519
FT                   /codon_start=1
FT                   /gene="Lats2"
FT                   /product="large tumor suppressor 2"
FT                   /db_xref="GOA:Q7TSJ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="MGI:MGI:1354386"
FT                   /db_xref="PDB:2COS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7TSJ6"
FT                   /protein_id="AAH53028.1"
FT                   /translation="MRPKTFPATTYSGNSRQRLQEIREGLKQPSKASTQGLLVGPNSDT
FT                   SLDAKVLGSKDASRQQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQ
FT                   ELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLAP
FT                   TPVTRRPSFEGTGEALPSYHQLGGANYEGPAALEEMPRQYLDFLFPGAGAGTHGAQAHQ
FT                   HPPKGYSTAVEPSAHFPGTHYGRGHLLSEQPGYGVQRSSSFQNKTPPDAYSSMAKAQGG
FT                   PPASLTFPAHAGLYTASHHKPAATPPGAHPLHVLGTRGPTFTGESSAQAVLAPSRNSLN
FT                   ADLYELGSTVPWSAAPLARRDSLQKQGLEASRPHVAFRAGPSRTNSFNNPQPEPSLPAP
FT                   NTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVAAPTAPATESLETKEGSAGPHP
FT                   LDVDYGGSERRCPPPPYPKHLLLPSKSEQYSVDLDSLCTSVQQSLRGGTEQDRSDKSHK
FT                   GAKGDKAGRDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQ
FT                   QKVSRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIG
FT                   AFGEVCLACKLDTHALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQ
FT                   DKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPD
FT                   NILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGNHMRQDSMEPGDLWDDVSNCRCGDRL
FT                   KTLEQRAQKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQPPF
FT                   LAPTPTETQLKVINWESTLHIPTQVRLSAEARDLITKLCCAADCRLGRDGADDLKAHPF
FT                   FNTIDFSRDIRKQPAPYVPTISHPMDTSNFDPVDEESPWHEASGESAKAWDTLASPSSK
FT                   HPEHAFYEFTFRRFFDDNGYPFRCPKPSEPAESADPGDADLEGAAEGCQPVYV"
FT   misc_difference 5146..5167
FT                   /gene="Lats2"
FT                   /note="polyA tail: 22 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 5167 BP; 1303 A; 1334 C; 1349 G; 1181 T; 0 other;
     ttcggaaccg cggcgtgagc gccccgggaa gatggagccg ccgccgccag cgccgccgcc        60
     gcttccccgg gctcccccga ccctccgggg tcagcaacca ctgccgccac cggcgcccgg       120
     tctcccggcg cgcgaggtcc cggagccgcg ggccaggacg ccgccgaggg tgtagagcgc       180
     tcccggagag agtgatggtc ttcaaaatga aaactctgga aaattttagg ttctctttag       240
     gaactacaaa aattgaagga cagcaatttt ttgaaaggaa gttgttctga aagcatgttt       300
     acaattcact gacactgttg actgttctct ttaaaataat aagacgcttt gagaagattg       360
     tatttatggt aaaaggaaac tggactaaca atgaggccaa agacttttcc tgccacaact       420
     tactctggaa atagccggca gcgattgcaa gagattcgag aggggctgaa gcagccatcc       480
     aaggcttcca cccaggggct gctggtggga ccaaacagtg acacttccct ggatgccaaa       540
     gtcctgggga gcaaagatgc ctccaggcag cagcaaatga gagccacccc gaagtttgga       600
     ccttatcaaa aagctctcag ggaaatccga tattccctcc tgccttttgc caacgagtca       660
     ggcacttcgg cagctgcaga ggtgaaccgg cagatgcttc aggagttggt gaatgcggga       720
     tgtgaccagg agatggctgg cagagcgctc aagcagacgg gcagtaggag tatcgaagct       780
     gccttggagt acatcagtaa gatgggctac ctggacccca ggaatgagca gattgtgcga       840
     gtcatcaagc agacctcccc aggaaagggc ctggcgccca ccccggtgac tcggcggccc       900
     agtttcgagg gcacagggga agcactccca tcctaccacc agctgggtgg tgcaaactac       960
     gagggccccg ccgcactgga ggagatgccg cggcaatatt tagactttct cttccctgga      1020
     gccggagccg gcacccacgg tgcccaggct caccagcatc ctcccaaagg gtacagcaca      1080
     gcagtagagc caagtgcgca ctttccgggc acacactatg gtcgtggtca tctactatcg      1140
     gagcagcctg ggtatggggt gcagcgcagt tcctccttcc agaacaagac gccaccagat      1200
     gcctattcca gcatggccaa ggcccagggt ggccctcccg ccagcctcac ctttcctgcc      1260
     catgctgggc tgtacactgc ctcgcaccac aagccggcgg ctaccccacc tggggcccac      1320
     ccattacatg tgttgggcac ccggggtccc acgtttactg gcgaaagctc tgcacaggct      1380
     gtgctggcac cgtccaggaa cagcctcaat gctgacttgt acgagctggg ctccacggtg      1440
     ccctggtctg cagctccact ggcacgccgc gactcgctgc agaagcaggg tctagaagcc      1500
     tcgcggccgc atgtggcttt tcgggctggc cccagcagga ccaactcctt caacaaccca      1560
     caacctgagc cctcactgcc cgcccccaac acggtcaccg ccgtgacggc cgcacacatc      1620
     cttcaccctg tgaagagcgt gcgtgtgctg cggcccgagc cccagacagc cgtggggccc      1680
     tcgcaccccg cctgggtggc tgcgcccaca gcacctgcca ctgagagcct ggagacgaag      1740
     gagggcagcg caggcccaca cccgctggat gtggactatg gcggctccga gcgcaggtgc      1800
     ccaccgcctc cgtacccaaa gcacttgctg ctgcccagta agtctgagca gtacagcgtg      1860
     gacctggaca gcctgtgcac cagtgtgcag cagagtctgc gagggggcac tgagcaagac      1920
     aggagtgaca agagccacaa aggtgcgaag ggagacaaag ctggcagaga caaaaagcag      1980
     attcagacct ccccggtgcc tgtccgcaag aatagcagag atgaagagaa gagagagtct      2040
     cgcatcaaga gttactcccc ttatgccttc aaattcttca tggagcaaca cgtggagaat      2100
     gtcatcaaaa cctaccagca gaaggtcagc cggaggctac agctggagca ggaaatggcc      2160
     aaagctgggc tctgtgaggc cgagcaggag cagatgagga agatcctcta ccagaaggag      2220
     tctaactaca accggctgaa gagggccaag atggacaagt ccatgtttgt gaaaatcaag      2280
     actctaggca tcggtgcctt tggggaagtg tgcctcgctt gtaagctgga cactcacgct      2340
     ctgtacgcca tgaagactct caggaagaag gatgtcctga accggaatca agtggcccat      2400
     gtcaaggctg agagggacat cctggctgaa gcagacaatg agtgggtggt caaactctac      2460
     tactccttcc aggacaagga cagcctgtac tttgtgatgg actacatacc aggcggggat      2520
     atgatgagcc tgctgatcag gatggaggtc ttccctgagc acctggcccg cttctacatt      2580
     gcagagttga ccctggccat tgaaagtgtc cacaagatgg gctttatcca ccgggacatc      2640
     aagcctgaca acatactcat cgacctggat ggtcatatta agctgacaga ttttggcctc      2700
     tgcactggat tcaggtggac tcacaattcc aagtactacc agaaagggaa ccacatgaga      2760
     caggacagca tggagcccgg tgacctctgg gacgatgttt ccaactgtcg ctgtggagac      2820
     aggttaaaga ccctggagca gagggcgcag aagcagcacc agaggtgcct ggcacattct      2880
     cttgtcggga caccaaatta catcgctccg gaggtgcttc tccgcaaagg gtacacgcag      2940
     ctctgtgact ggtggagcgt cggtgtgatt ctctttgaga tgctggttgg gcagccgcct      3000
     ttcttggccc ccacccccac agagacgcag ctgaaggtga tcaactggga gagcacgctg      3060
     catatcccta cgcaggtgag gctcagcgct gaggcccgag acctcatcac gaagctgtgc      3120
     tgcgcggctg actgccgcct gggcagggat ggggcagatg acctcaaggc acacccgttc      3180
     ttcaacacca tcgacttttc ccgtgacatc cgaaagcagc ctgcacccta cgtccccacc      3240
     atcagccacc ccatggacac ctccaatttt gacccggtgg atgaagaaag cccctggcac      3300
     gaggccagcg gagagagcgc caaggcctgg gacacgctgg cctcccccag cagcaagcat      3360
     ccagagcacg ccttctatga gttcaccttc cgcaggttct tcgatgacaa cggctatccc      3420
     ttccggtgcc cgaagccctc agagcccgca gagagtgcag acccagggga tgcggacttg      3480
     gaaggtgcgg ccgagggctg ccagccggtg tacgtgtaag cctcagttaa ccacaactcg      3540
     aggaaaccca aaatgagatt tcttttcaga agacaaactc aagcttagga atccttcatt      3600
     tttagttctg gtaaatgggc aacaggaaga gtcaacatga tttcaaatta gccctctgag      3660
     gaccttcact gcattaaaac agtattttta aaaaattagt acagtatgga aagagcactt      3720
     attttgtgga tacccatctt tttcttacta aattataagg actgactgtg agaaaccatg      3780
     ctgctgttat ttccatgtgt gttgtatctg atagcacttg tccacagcta gaaaaggaag      3840
     agctggagag cgtgaggcaa gacgtctgtg caataagaga ggatgaggcg acggagctct      3900
     gctcaagtca cgaggaccgc ttatctacac agtggcttag ttttgtattt tcccacattt      3960
     caaattgtga tgtaatgttt gaaagctgct tttgtatttt ctcctttgca tattatagtt      4020
     cctagaaaga gtgagcagag agctggtggg tgtgactccg gtgtctggtg tggagagtac      4080
     tgcatgagca ggggtttcta gtataaaata ccgtatcttg ccattcacag caggtcctgt      4140
     gaatacgttt ttaaatgagg tattctagac agtgtgctga taatgtattg tgtggatgtg      4200
     tgttaaagaa atgcatatgt ataactgaag tgtgattttt ttttaatgtg tgtgtgtctt      4260
     ggatatgact gagttcttcg ggaggcaaat gtaaacattt gtcatatata aaacacatca      4320
     aaagggatta agtcagcttt gccaaaacat tgacataatt ctagcgtttt gtccatttcc      4380
     gtagtcctgt ctgctgtcag gtgtggctgt gggagctgga ccctgctatt cattctttca      4440
     ctcacagggt tcccgcagcc ataggtgatg taagggtcct gcttcctgtg ttctcagcca      4500
     accaggaggt tctgtgaaac ccagttcttt gggcctcttt cacatgagag gtgtctgtca      4560
     catctcaatg tgacttaata cgtttttcta actttgtaaa aagaaaaaaa gattctttga      4620
     agcaacattg gagtacaaaa acaagccata cttttttctt agacatatag gtgtgtatat      4680
     aactatagat aaacacacaa aatagtcctt atttcaaatt agtacgcttc ctacttaagg      4740
     tgatttatat ttgagtacat tcagtttctt ttgcttttca aggatggaac acatcccatt      4800
     ttcattatgc tatgccaaat cttctcacca aggttcttag cacagtgcac ccgttactta      4860
     gtattatcta ggcagaaaca cttacaaatt tatctatgtc taagaaacat tcctgtgtct      4920
     ggtttacatt tgtatgaatg gcatattctg aagtctgctg tgcttgtatt gtgacttaca      4980
     gtattctcgc tattttgtag taatgccgtg ttatttacag cgctctgaca tagtttgatg      5040
     tggtaggttc tttctcagga actcaattta actattattt attgatatat cattgccttt      5100
     gaaagcttct actggcacaa tttattatta aaactttaaa gcctaaaaaa aaaaaaaaaa      5160
     aaaaaaa                                                                5167
//


spacer
spacer