Dbfetch

ID   BC053010; SV 1; linear; mRNA; STD; MUS; 4150 BP.
XX
AC   BC053010;
XX
DT   06-JUN-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus frizzled homolog 1 (Drosophila), mRNA (cDNA clone MGC:62195
DE   IMAGE:5697795), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4150
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4150
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JUN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 13fb56b14773c1d692effd4ede44efde.
DR   Ensembl-Gn; ENSMUSG00000044674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054294; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 114 Row: e Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981156.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4150
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FI0"
FT                   /clone="MGC:62195 IMAGE:5697795"
FT                   /tissue_type="Brain, enriched mouse brain 12.5dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4150
FT                   /gene="Fzd1"
FT                   /note="synonym: FZ-1"
FT   CDS             392..2320
FT                   /codon_start=1
FT                   /gene="Fzd1"
FT                   /product="frizzled homolog 1 (Drosophila)"
FT                   /db_xref="GOA:O70421"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026548"
FT                   /db_xref="MGI:MGI:1196625"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70421"
FT                   /protein_id="AAH53010.1"
FT                   /translation="MAEEAAPSESRAAGRLSLELCAEALPGRREEVGHEDTASHRRPRA
FT                   DPRRWASGLLLLLWLLEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGIS
FT                   IPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFF
FT                   LCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELC
FT                   VGQNTSDKGTPTPSLLPEFWTSNPQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYL
FT                   NYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDM
FT                   RRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTI
FT                   LFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITIL
FT                   ALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH
FT                   DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPC
FT                   PHLQGGGGVPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNS
FT                   KQGETTV"
FT   misc_difference 2990
FT                   /gene="Fzd1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 4134..4150
FT                   /gene="Fzd1"
FT                   /note="polyA tail: 17 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4150 BP; 889 A; 1158 C; 1139 G; 964 T; 0 other;
     gcggcggaga aggaggaggc ggaggcgcag gggggaccca gggcggctag gctgccgaga        60
     gttgggcgct cctctgcccg gctgcgacca ctaacgcggc gccgcctgac aagagccaca       120
     gcctgccgcg ggccagggaa gagggacgcg accccggcgc gcctggacca ctcttgctct       180
     cctcgccgcc cgcgcttcat gaaccgcaag tttccgcggc ggcggcggcg gctgcgggac       240
     gcggagcaga atcccgggga gcgggcagag agcggccgca ccccgacgga gggcacgggc       300
     gaccagctct cccggatcac agtgggagcc accacccgcc gcgccgctgc ccgtcccagt       360
     caatccgcgc cgaggaggga gccgaaaaag tatggctgag gaggcggcgc ctagcgagtc       420
     ccgggccgcc ggccggctga gcttggaact ttgtgccgaa gcactcccgg gccggcggga       480
     ggaggtgggg cacgaggaca cggccagcca ccgccgcccc cgggctgatc cccggcgttg       540
     ggctagcggg ctgctgctgc tgctttggtt gctggaggct cctctgcttt tgggggtccg       600
     agcgcaggcg gcgggccagg tatccgggcc gggccagcaa gccccgccgc cgccccagcc       660
     ccagcagagc gggcagcagt acaacggcga acggggcatc tccatcccgg accacggcta       720
     ctgccagccc atctccatcc cgctgtgcac ggacatcgcg tacaaccaga ccatcatgcc       780
     caacctgctg ggccacacga atcaggagga cgccggtctg gaggtgcacc agttctaccc       840
     tctggtgaag gtgcagtgct ccgccgagct caagttcttc ctgtgctcca tgtacgcgcc       900
     tgtgtgcacc gtactggagc aggcgctacc gccctgccgc tccctgtgcg agcgcgcacg       960
     ccagggctgc gaggcgctca tgaacaagtt cggcttccag tggccagaca cactcaagtg      1020
     cgagaagttc ccggtgcacg gcgcaggaga gctgtgcgtg ggccagaaca cgtccgacaa      1080
     aggcacccca actccctcct tgctaccaga gttctggacc agtaatccgc agcacggcgg      1140
     cggtggttac cgcggcggct acccgggggg tgccgggacg gtggagcggg gaaagttctc      1200
     ctgcccgcgc gccctcaggg tgccctccta cctcaactac cactttctgg gggagaagga      1260
     ctgcggcgca ccctgcgaac ccaccaaggt ttacgggctc atgtacttcg ggccagagga      1320
     gctgcgcttc tcgcgcacct ggataggcat ctggtccgtg ctgtgctgcg cctccacgct      1380
     cttcacggtg ctcacgtacc tagtggacat gcggcgcttc agctacccgg aacggcccat      1440
     cattttcctg tccggctgtt acacagcggt ggcggtggcc tacatcgctg gctttctgtt      1500
     ggaggaccgg gtggtgtgca acgacaagtt tgcagaggac ggggcgcgca cggtggcgca      1560
     gggcactaag aaagaaggct gcactatact ctttatgatg ctctacttct tcagcatggc      1620
     cagctccatc tggtgggtga tcctgtccct cacctggttc ctggcagccg gcatgaagtg      1680
     gggccacgaa gccatcgagg ccaactcaca gtatttccat ttagccgcct gggctgtgcc      1740
     agccatcaaa actataacca tcttggcgtt gggccaggtg gatggcgacg tactgagcgg      1800
     agtgtgtttt gtggggctca acaacgtgga cgcactgcgt ggctttgtgc tggcgcctct      1860
     cttcgtttat ctgttcattg gcacttcttt cctgctggcc ggtttcgtgt cactcttccg      1920
     catccgcacc atcatgaagc atgacggcac caagacagag aagctggaga agctcatggt      1980
     gcgcatcgga gtcttcagtg tcctctacac tgtgccggcc accatcgtca tcgcctgcta      2040
     cttctatgaa caggcctttc gggaccagtg ggagcgcagc tgggtggccc agagctgcaa      2100
     gagttatgcc atcccttgcc ctcacctcca gggaggtgga ggagtcccac cacacccgcc      2160
     catgagccca gactttacag tcttcatgat caagtatctc atgacgctga ttgtgggcat      2220
     cacatcgggc ttctggatct ggtccggcaa gacactgaat tcctggagga agttctacac      2280
     gaggcttacc aacagcaaac agggggagac taccgtctga aacccagact cttaccttac      2340
     ccttttttgg cctgatccta gccatcgcct ggaagctggc cccaaggaat tcctgccaag      2400
     cctggccact ccaggcttcc tcgccagcca ctgacttttg caggcccctt tcccaacaaa      2460
     cagcacaggt tctgcaaaag cttccgtccc tggggtaaag gaacgagagg gcccaactga      2520
     tcgaggtgta tgtgtatgtg cgtgtggacc gatctctcta gccctctctg ataccaggat      2580
     tgtacgcttt tatgattgta aatagcctgt gtaagatttt tgtacgtata tttgtattta      2640
     aagactatcg aacacgcagt ttttttttct ttttaaaaat gtttaattat ttagggcaat      2700
     ttacgtattt ggagcttttc tcacttgccc ttttctgcag attgcagagg aggtaaaaca      2760
     gagcacactt gactaagtgc tttgccctgt gccctcatct ttgtcaaggg agcatgggcc      2820
     tgcctctcca gggtcatttc cttcagcatc tcccgcccct ccccttcctt gcttgcagtg      2880
     ggaaatttta aggtgcagaa ctctgtaaag cttccagatc ccgaggtggg ccccgcccat      2940
     tccagatcct ccccttttca gcggtagagt gtggatggct gtccctgtgg cttcctgatg      3000
     ctgcttattt gagatccacc ttccagcttt attagaggac cccagtatgg gctctgccag      3060
     ttgacccagc ctccctgtac cccggtgtcc cttgcccagt gtctttctcc ttgcacctaa      3120
     gttgttcaga gggagtgcag taaccgaccg atagcgaact ttggagagtc tgacttttta      3180
     tggatgagct catttttact ctctagtatc tggaacttgc tctgggtctg gtcatcatca      3240
     tggaaagagc agcaagcttt gtgggttggg agaggctaaa gagagaggtt ataaaacatt      3300
     agttctaatt gcattctgat gtctggcaac ctactttctt ccccctgtga tgctgcctgc      3360
     ttctagattt tacccttcta tgaaatgcag acctcgaggt tgcctgggaa gcttggtgaa      3420
     ggaatggttt accttcctta acaggatagt agaacataca cagagtatgg aaacctaagg      3480
     agatttcagt gaagtggagt tactccaagt gaaacgctgt tttctggttt tagccaaact      3540
     gcaattagat gtgtctttgc aatctaaaag ttgtacacaa tcaacaatac actttgctta      3600
     ctcctcagca gcacattctg agggagaaac agtcacaccc ccgcagaaag cctggttgga      3660
     cttccgaaga cagaggcggt ggactgacgg atgggtgaga gagacaaaca cgacctaggc      3720
     atgcatgctg aaggggaagt gtgtccattc ctactgcatc ccatcttgtg tgctcctgtc      3780
     tggatttacg gcagtgtgtc aaatgtaaat ctctcaaagc catttaaaaa tactcacttt      3840
     agttatggat gaagaagagg agaaaagcag tcctcctgat tgtagtgttt aaaccttaag      3900
     agtttatcac aaatgccgat acatacatag gacctaaatt tatctatgtc tgtcataccc      3960
     taaaatgaca ttggtttttg gatttggtat gcattattat tgttattatt gttattatta      4020
     ttctcaccac catgagatca tctatattta tagaggaata gaagtttata tatataaaat      4080
     gccatatttt taatttcgca aataaaaaaa tgaaagtttt gtacaaaatt acaaaaaaaa      4140
     aaaaaaaaaa                                                             4150
//