spacer

EBI Dbfetch

ID   BC052321; SV 1; linear; mRNA; STD; MUS; 2788 BP.
XX
AC   BC052321;
XX
DT   06-MAY-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus fatty acid amide hydrolase, mRNA (cDNA clone MGC:58928
DE   IMAGE:6515634), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2788
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2788
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-MAY-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d92237a6bb2f517cb1fe0e2a9c5ce265.
DR   Ensembl-Gn; ENSMUSG00000034171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049095; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 108 Row: o Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542794.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2788
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="MGC:58928 IMAGE:6515634"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2788
FT                   /gene="Faah"
FT   misc_difference 1..19
FT                   /gene="Faah"
FT                   /note="19 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 22
FT                   /gene="Faah"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 25
FT                   /gene="Faah"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   CDS             288..2027
FT                   /codon_start=1
FT                   /gene="Faah"
FT                   /product="fatty acid amide hydrolase"
FT                   /db_xref="GOA:O08914"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR030560"
FT                   /db_xref="MGI:MGI:109609"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08914"
FT                   /protein_id="AAH52321.1"
FT                   /translation="MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRAR
FT                   QKQRAGLETMDKAVQRFRLQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKA
FT                   WEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVT
FT                   SESDCVVVQVLKLQGAVPFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEG
FT                   ALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVG
FT                   PMARDVDSLALCMKALLCEDLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTP
FT                   AMRRAVMETKQSLEAAGHTLVPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDP
FT                   CLGDLVLVLKLPRWFKKLLSFLLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSV
FT                   IAQWKAMNLDVVLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDD
FT                   AQMEHYKGYFGDMWDNILKKGMKKGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEK
FT                   RPS"
FT   misc_difference 1043
FT                   /gene="Faah"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2725..2788
FT                   /gene="Faah"
FT                   /note="polyA tail: 64 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2788 BP; 587 A; 798 C; 788 G; 615 T; 0 other;
     ggcgccctcc aaagcaccag ggcggccacg cggagctcgt ctgttccgcc tgccttaaaa        60
     cgctggcacg ccaggaaccg ggccagaagg ggtctaggct tgaccttgac cgttggagct       120
     gctagcttgg ctctcgctgc cgggcaacgg cgcgctcccc gcgggcccgc ggctgcgcct       180
     gcccctccct caagcggaat cgcgggcgat ccaggccggg ttttgcagcg gagctgttgg       240
     tgtgcgcgtg ccgagtcctc tcgggtggcg gtcggctgca ggagatcatg gtgctgagcg       300
     aagtgtggac cgcgctgtct ggactctccg gggtttgcct agcctgcagc ttgctgtcgg       360
     cggcggtggt cctgcgatgg accaggagcc agaccgcccg gggcgcggtg accagggcgc       420
     ggcagaagca gcgagccggc ctggagacca tggacaaggc ggtgcagcgc ttccggctgc       480
     agaatcctga cctggattca gaggccttgc tggctctgcc cctgctccaa ctggtacaga       540
     agttacagag tggggaactg tccccagaag ctgtgctctt tacctacctg ggaaaggcct       600
     gggaagtgaa caaagggacc aactgtgtga cctcctatct gactgactgt gagactcagc       660
     tgtcccaggc cccacggcag ggcctgctct atggcgtccc cgtgagcctc aaggaatgct       720
     tcagctacaa gggccatgct tccacactgg gcttaagttt gaacgagggt gtgacatcgg       780
     agagtgactg tgtggtggtg caggtactga agctgcaggg agctgtgccc tttgtgcaca       840
     ccaacgtccc ccagtccatg ctaagctatg actgcagtaa ccccctcttt ggccagacca       900
     tgaacccgtg gaagccctcc aagagtccag gaggttcctc agggggtgag ggggctctca       960
     ttggatctgg aggctcccct ctgggtttag gcactgacat cggcggcagc atccggttcc      1020
     cttctgcctt ctgtggcatc tgcggcctca agcctactgg gaaccgcctc agcaagagtg      1080
     gcctgaagag ctgtgtttat ggacagacag cagtgcagct ttctgttggc cccatggcac      1140
     gggatgtgga tagcctggca ttgtgcatga aagccctact ttgtgaggat ttgttccgct      1200
     tggactccac catccccccc ttgcccttca gggaggagat ctacagaagt tctcgacccc      1260
     ttcgtgtggg atactatgaa actgacaact acaccatgcc cactccagcc atgaggaggg      1320
     ctgtgatgga gaccaagcag agtctcgagg ctgctggcca cacgctggtc cccttcttac      1380
     caaacaacat accttatgcc ctggaggtcc tgtcggcagg tgggctgttc agtgatggtg      1440
     gctgctcttt tctccaaaac ttcaaaggcg actttgtgga tccctgcttg ggggacctgg      1500
     tcttagtgct gaagctgccc aggtggttta aaaaactgct gagcttcctg ctgaagcctc      1560
     tgtttcctcg gctggcagcc tttctcaaca gtatgtgtcc tcggtcagcc gaaaagctgt      1620
     gggaactgca gcatgagatt gagatgtatc gccagtccgt cattgcccag tggaaggcaa      1680
     tgaacttgga cgtggtgcta acccccatgc tgggtcctgc tctggatttg aacacaccgg      1740
     gcagagccac aggggctatc agctacactg ttctctataa ctgcctggac ttccctgcgg      1800
     gggtggtgcc tgtcaccact gtgaccgctg aggacgatgc ccagatggaa cactacaaag      1860
     gctactttgg ggatatgtgg gacaacattc tgaagaaggg catgaaaaag ggtataggcc      1920
     tgcctgtggc tgtgcagtgc gtggctctgc cctggcagga agagctgtgt ctgcggttca      1980
     tgcgggaggt ggaacggctg atgacccctg aaaagcggcc atcttgaggg tcattcatct      2040
     gcccagctct ggaggaccta aggcccatgc gctctgcact gcagccccat ctattcagga      2100
     tcctgccacc catgaggaga tgcccagcac gggaagaggc aaccacctgc cctcccctgg      2160
     actcctacag aaacccagga catgccctcc ataaccaagt ctggaccttg ctcccctttc      2220
     tggtctactt tccatcctga ccccctactc tatgtgacag cccagcagga acgacacggg      2280
     ccaaggacca ccaacagtca aaaaaagcaa tgtgtttctg tatttttctg ggtatttttc      2340
     tattaggacc ttggaaccag agcctgctga gagggctgtg ctgtccctcc agagctggct      2400
     gtaatcatgt cactctcctg ctccaaagcc tccctaggcc atcacccaca aggtagacac      2460
     agggacatgt ccttggcact tggctcctgc ccttccttcc ttgttcagat tggccccagc      2520
     tttgatggac accgcccggg tcttcctccc tcattccacc tctctctctt ctgacttggc      2580
     ctttttactt ctctagctgt tgtagagaac aaggtttctc tgtgtagccc tggctgtcca      2640
     ggatctcact ctgtagatca ggctggcttt cagctcacaa ggctgcctgc ctgggtgctg      2700
     ggattaaagg cgtgtgttac cagaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2760
     aaaaaaaaaa aaaaaaaaaa aaaaaaaa                                         2788
//


spacer
spacer