Dbfetch

ID   BC052023; SV 1; linear; mRNA; STD; MUS; 1312 BP.
XX
AC   BC052023;
XX
DT   06-MAY-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus syntaxin 4A (placental), mRNA (cDNA clone MGC:62370
DE   IMAGE:5711022), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1312
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1312
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAY-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 83d4d4a84dbcd9432b3dce0e82b61c58.
DR   Ensembl-Gn; ENSMUSG00000030805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121705; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 114 Row: j Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981984.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1312
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_ER0"
FT                   /clone="MGC:62370 IMAGE:5711022"
FT                   /tissue_type="Brain, mouse 15 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1312
FT                   /gene="Stx4a"
FT                   /note="synonyms: Stx4, Syn4"
FT   CDS             168..1064
FT                   /codon_start=1
FT                   /gene="Stx4a"
FT                   /product="syntaxin 4A (placental)"
FT                   /db_xref="GOA:P70452"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="MGI:MGI:893577"
FT                   /db_xref="PDB:3PUJ"
FT                   /db_xref="PDB:3PUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70452"
FT                   /protein_id="AAH52023.1"
FT                   /translation="MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKV
FT                   QIIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAI
FT                   EPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKIT
FT                   NAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHE
FT                   IFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVS
FT                   VTVLILAVIIGITITVG"
FT   misc_difference 307
FT                   /gene="Stx4a"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; amino acid
FT                   difference: 'I' in cDNA, 'T' in the mouse genome."
XX
SQ   Sequence 1312 BP; 343 A; 299 C; 409 G; 261 T; 0 other;
     cttccccacg actgtggatg gtgaaagggg tggggccttt ggcggctccg gggtgtactg        60
     gagttcgctg ggtgagggag ggggtgtcaa gtgtgagaga ggtgcaggac ttccaaattt       120
     agaaccttga ggccctttgg gctcgggtcc agggcactcc gaccaccatg cgcgacagga       180
     cccacgagtt gaggcagggg gataacatct cagacgatga agatgaggtt cgagtcgcgc       240
     tggtggtgca ctcaggtgct gcccggttgg gcagcccgga cgacgagttc ttccagaagg       300
     tgcagataat tcggcagact atggccaaac tggagagtaa agtccgggag ttggagaaac       360
     agcaggtcac catcctggcc acgcctcttc ccgaggagag catgaagcag ggcctgcaga       420
     acctgcgaga ggagatcaaa cagctgggga gagaggtccg ggcgcagcta aaagccatag       480
     agccccagaa ggaggaagct gatgagaatt acaactcagt caacacaagg atgaagaaaa       540
     cccagcatgg agtcctgtcc cagcaatttg tcgagctcat caacaagtgc aactcaatgc       600
     agtccgaata ccgagagaag aatgtggagc ggatccggag gcagctgaag atcaccaatg       660
     ctggaatggt gtctgacgag gagctggaac agatgctgga cagtgggcag agtgaggtgt       720
     ttgtgtctaa tatcctgaag gacacgcagg tgactcggca ggccctgaat gagatctctg       780
     cgcggcacag tgagatccag cagttggagc gcagtatccg agagctccat gagatcttta       840
     cgtttctagc tacggaggtg gagatgcagg gggagatgat caaccgcatc gagaagaaca       900
     tcctgagctc ggccgactac gtggaacgtg ggcaagagca cgtcaagata gccctagaga       960
     atcagaagaa ggcgaggaag aaaaaagtca tgattgccat ctgtgtctct gtcactgttc      1020
     tcatcttggc tgtcatcatt ggcatcacca taaccgttgg ataatgtcac atgttcttgg      1080
     cattgggaga gacagagacc cagcttttgt ggaggtgggg caggcctcca actgaacccg      1140
     tccgcacact ggaccttgtg cagagggcct gcggctcgtc ctgggttggc agctgctcat      1200
     tcatggagtc ctcccctgga gtcctccaca atgcctgcga gacagttttc aatgtcctgt      1260
     ttgtctggga tacatggttt tgtaaaaaat ttaaaaaaaa aaaaaaaaaa aa              1312
//