Dbfetch

ID   BC051984; SV 1; linear; mRNA; STD; MUS; 2235 BP.
XX
AC   BC051984;
XX
DT   06-MAY-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus CD200 antigen, mRNA (cDNA clone MGC:62285 IMAGE:5707683),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2235
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2235
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAY-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 55dd9bfe0c31ab170390fd7b78929807.
DR   Ensembl-Gn; ENSMUSG00000022661; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022851; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022816; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022788; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022817; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022581; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023264; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022106; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022552; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022684; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022660; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022752; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022678; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023279; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021846; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022151; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000163230; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0044565; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0044542; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0044517; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0044518; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0044260; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045001; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0044377; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0044175; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0044326; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0044280; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0044403; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0044256; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0045058; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0043958; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0043634; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 114 Row: h Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543262.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2235
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EV0"
FT                   /clone="MGC:62285 IMAGE:5707683"
FT                   /tissue_type="Brain, mouse 15.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2235
FT                   /gene="Cd200"
FT                   /note="synonym: OX2"
FT   CDS             105..941
FT                   /codon_start=1
FT                   /gene="Cd200"
FT                   /product="CD200 antigen"
FT                   /db_xref="GOA:Q80VX2"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033321"
FT                   /db_xref="MGI:MGI:1196990"
FT                   /db_xref="UniProtKB/TrEMBL:Q80VX2"
FT                   /protein_id="AAH51984.1"
FT                   /translation="MGSLVFRRPFCHLSTYSLIWGMAAVALSTAQVEVVTQDERKALHT
FT                   TASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNS
FT                   SITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSAT
FT                   ARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNV
FT                   IDYKQSLDKGFWFSVPLLLSIVSLVILLILISILLYWKRHRNQERGESSQGMQRMK"
FT   misc_difference 2221..2235
FT                   /gene="Cd200"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2235 BP; 618 A; 494 C; 487 G; 636 T; 0 other;
     ggcgaatagt agtgtccctg ctcacaggtg ttgcggagat atcctccatc gtggaagagc        60
     tcagaccccg agaagctggt gtctagctgc ggcccagagc aaggatgggc agtctggtat       120
     tcaggagacc tttctgccat ctctccacct acagcctgat ttggggcatg gcagcagtag       180
     cgctgagcac agctcaagtg gaagtggtga cccaggatga aagaaaggcg ctgcacacaa       240
     ctgcatcctt acgatgttct ctaaaaacat cccaggaacc cttgattgtg acatggcaga       300
     aaaagaaagc cgtgagccca gaaaacatgg tcacctacag caaaacccat ggggttgtaa       360
     tccagcctgc ctacaaagac aggataaatg tcacagagct gggactctgg aactcaagca       420
     tcaccttctg gaacacaaca ttggaagatg agggctgcta catgtgtctc ttcaacacgt       480
     ttggttctca gaaggtctca ggaacagctt gccttaccct ctatgtacag cccatagtac       540
     accttcacta caactatttt gaagaccacc taaacatcac ttgctctgcg actgcccgtc       600
     cagcccctgc catctcctgg aagggtactg ggacaggaat tgagaatagt accgagagtc       660
     acttccattc aaatgggact acatctgtca ccagcatcct ccgggtcaaa gaccccaaaa       720
     ctcaagttgg gaaggaagtg atctgccagg ttttatacct ggggaatgtg attgactaca       780
     agcagagtct ggacaaagga ttttggtttt cagttccact gttgctaagc attgtttctc       840
     tggtaattct tctgatcttg atctccatct tactatactg gaaacgtcac cgaaatcagg       900
     agcggggtga atcatcacag gggatgcaaa gaatgaaata agagctctaa agaaattata       960
     cagaaccctg aacgtgtttc cctggtctac ttgaatctga tgtgaaagaa aagcaggagg      1020
     gaaaaggcca ttctccatag gacctaagga gagcaaaaga ccagacacga gcctgtgagg      1080
     gatttgactt tttgctgttg tcccaggtcc tcggtgtttg cattccaaga ggaagtcgag      1140
     tgcctcgggt ctgttgtagg acttgatttt tttttttttt gtagagcaat gcagtgccat      1200
     gctgttagaa aggctccaga cttagaacca ccagtgccaa gccagctctc agaccgacta      1260
     gggctcccat cggaggaaca aatcgtagtc aacttacctc acagagctct ctggtcctta      1320
     cacaaagtag aaaggagtgg gaccagaaaa ttggccatgt ctgaaatctg atggaatttt      1380
     taggaagaaa actgaagaat aagcaaaaga agaaagaaca cagaagggtc caaagagctt      1440
     ctgagagtac cttttgcctt tctgttggtg tcccagctct ggttttgttc ttaggtccgc      1500
     cagtgtgttt ccctgttgtt tgagtatcta gttgactacc tgctactgtt ctgctgatgg      1560
     ttggccttgc tagaatccct gactcccctg ccgttctcta tgtgcttcta tgagggttac      1620
     tatgatgaaa atagagcaga agatagtgtg aagtaacatt ggcaactgta atgtgtccat      1680
     ttaacttatt tttatagcac ttaggcaata ttgttagtct tagtgagtag ttcacatctt      1740
     tacaaaagca tgctctccct atccattggg cccacaataa cactctcttt gaggccattc      1800
     tgaatcctgt ctcgtgtaat gataatatat tatgaaaaca gatactttaa gaatttcctg      1860
     tacagcagtc agttgtttat tctctctctc tctctctctc tctctctccc tcccccaccc      1920
     cagcttcttt ttctgtgact ttgtttttca taaagagaag gcatctcctg aatacaatcg      1980
     ctttgttctg aagacatcgt gaactattaa ttcttaaccc tttgacaaaa ctagtgaagt      2040
     tgttttctgt atcttttgct tcatctgtct ttatagagtg acctaggaat tcaagtgtaa      2100
     gttgtttcca ttgttgaact ggatatttat atacttggta tgcttttcac gtgttattta      2160
     attctgtata atttcctata tttgtattaa aatattgagc aattaaaagt gtcaactaaa      2220
     aaaaaaaaaa aaaaa                                                       2235
//