spacer

EBI Dbfetch

ID   BC051976; SV 1; linear; mRNA; STD; MUS; 2690 BP.
XX
AC   BC051976;
XX
DT   15-MAY-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus protein tyrosine phosphatase, receptor type, O, mRNA (cDNA
DE   clone IMAGE:5697561), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2690
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2690
RA   Strausberg R.;
RT   ;
RL   Submitted (01-MAY-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; c865b3b744dec5943583e3bb2387686c.
DR   Ensembl-Gn; ENSMUSG00000030223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077115; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 114 Row: e Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6997246.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2690
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EQ0"
FT                   /clone="IMAGE:5697561"
FT                   /tissue_type="Brain, whole, 18.5 dpc mouse embryo"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            <1..2690
FT                   /gene="Ptpro"
FT                   /note="synonyms: GLEPP1, PTP-BK, PTP-U2, PTPROt, PTP-phi"
FT   CDS             <1..1527
FT                   /codon_start=1
FT                   /gene="Ptpro"
FT                   /product="Ptpro protein"
FT                   /db_xref="GOA:Q80W11"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1097152"
FT                   /db_xref="UniProtKB/TrEMBL:Q80W11"
FT                   /protein_id="AAH51976.1"
FT                   /translation="RGSNTSLPRLVKLEPAPPKSLFAVNKTQTSVTLLWVEEGVADFFE
FT                   VFCQQLGSGHNGKLQEPVAVSSHVVTISSLLPATAYNCSVTSFSHDTPSVPTFIAVSTM
FT                   VTEVNPNVVVISVLAILSTLLIGLLLVTLVILRKKHLQMARECGAGTFVNFASLEREGK
FT                   LPYSWRRSVFALLTLLPSCLWTDYLLAFYINPWSKNGLKKRKLTNPVQLDDFDSYIKDM
FT                   AKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEG
FT                   ADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSHIIVMLTQCNEKRRVKCD
FT                   HYWPFTEEPIAYGDITVEMVSEEEEEDWASRHFRINYADEAQDVMHFNYTAWPDHGVPP
FT                   ANAAESILQFVFTVRQQAAKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILG
FT                   LVSEMRSYRMSMVQTEEQYIFIHQCVQLMWLRKKQQFCISDVIYENVSKS"
FT   misc_feature    52..291
FT                   /gene="Ptpro"
FT                   /note="fn3; Region: Fibronectin type III domain"
FT   misc_feature    685..1452
FT                   /gene="Ptpro"
FT                   /note="PTPc; Region: Protein tyrosine phosphatase,
FT                   catalytic domain"
XX
SQ   Sequence 2690 BP; 714 A; 633 C; 629 G; 714 T; 0 other;
     agagggagca acacctcctt gccccgcctt gtcaagctcg aaccagcccc tccgaagtca        60
     ctcttcgcag tgaacaaaac acagacgtca gtgaccctgc tgtgggttga ggagggtgtt       120
     gctgatttct ttgaagtctt ctgtcagcag ctcggctctg gccacaatgg caaactccag       180
     gagccagtag ctgtgtcgtc ccacgtggtg accatctcca gcctcctccc agccactgcc       240
     tacaactgca gtgtcaccag cttcagccac gacactccca gtgtccctac attcatagct       300
     gtctccacaa tggttacaga ggtgaaccct aacgtggtgg tgatctcggt gctggccatc       360
     ctcagcacac ttttaattgg actgctctta gtgacccttg tcattctccg aaagaagcac       420
     ctgcagatgg ctagggaatg tggagctggc acgtttgtta actttgcatc cttagaaagg       480
     gaagggaaac tcccctacag ttggcgtagg agtgtgtttg ctctcttaac cctgctgcct       540
     tcatgtcttt ggactgacta tcttttggca ttttatatta acccttggag taaaaatggc       600
     ttaaagaaga ggaaactaac aaaccccgtt cagctggatg acttcgattc ttacatcaag       660
     gatatggcca aggactcgga ctataaattc tctcttcagt ttgaggagtt gaagttgatt       720
     ggactggata ttccgcactt tgctgcagat ctaccgctga accgatgtaa aaaccgctac       780
     acaaacatcc tgccgtatga ctttagccgg gtgaggctag tctccatgaa cgaagaggaa       840
     ggagcagact acattaatgc caactatatt cctggataca actcacccca ggagtacatt       900
     gccacccagg gtcccctgcc agaaaccaga aatgacttct ggaagatggt cctacaacag       960
     aagtcccaca tcatcgtcat gctcactcaa tgcaatgaga aaaggagggt aaaatgtgac      1020
     cactactggc cattcacaga agaacccatt gcttatgggg acatcaccgt ggagatggtc      1080
     tctgaggaag aggaggagga ctgggccagt agacacttcc ggatcaacta tgcggacgaa      1140
     gcgcaggacg tgatgcattt taactacaca gcctggcccg atcacggcgt gcctccagca      1200
     aacgccgccg agagcatcct gcagtttgtg ttcacagtgc gacagcaagc cgccaagagc      1260
     aaagggccca tgatcatcca ctgcagtgcg ggtgtgggac ggacaggaac cttcattgcc      1320
     ctggacaggc tcctgcaaca cattcgagat catgaatttg tggacatctt agggctggta      1380
     tcagagatgc gctcataccg aatgtcaatg gtacagacag aggagcagta catttttatc      1440
     catcagtgtg tgcagctgat gtggctgagg aagaagcaac agttctgcat cagcgacgtc      1500
     atctacgaga acgtcagcaa atcctagttc ggaatctgga gcggtgagga catgatacct      1560
     gcgcatcctc ccttgcttcc agagttttta taggggcttt tagtcacttt gctaaatcga      1620
     gtccctgctg tgcagtatat ggacaaggag gagatttacc tcctagaacc aagaagacct      1680
     taaggagcct acagtatcat ttggagtctt ttcacttcta gatgtttgat ggaccaaatt      1740
     cagtagaatt ccagaaaggt caccaatgct ccttgagggg caggaagcgc aatacttcct      1800
     gatggctcag ttggctcttt gctgctcggg ttgggttgat ttttttttta agtgcaataa      1860
     tttctgtata attgtgattt tttacattca caattcagaa tgttgaattg ttatctgccc      1920
     acaccatcga tcagtgccac agccttggaa ataaccaaca tcattacgga gttttatctc      1980
     atccctggaa aggcatggct acacaggaag acgtggtgat gaatctcctt caaagaaact      2040
     gagcgagtgt gctcctcgct ccaaccttga agctacgggt caggagtagg caggcagagg      2100
     gaagagagcg gttctactca cccatcagcc agcttatctt ttcctatttc aaatatgaaa      2160
     acctgtgttt caaagtagag taggaaaaac attatatgtc tgacttgtca tagtgggttt      2220
     cttccttgtt gacagttggg agtttcttcc gtggctcttt tgaactaatg tcacggtcct      2280
     ttttgaacag ccagagttga ttcaacagtt ttgagtctga ctctgaactc tgagatatct      2340
     tggtgcctag ccttcacgtt tatttttctc tgtgtccacc tgtgtacaca aaaacagttt      2400
     ctccaagagc tataggctgt aaaaatgcac tttctttctc cacccagagg agctgggaat      2460
     tcagaagtca cgacaacaac aaactcagca tgtaaggaca ggtattggac accatccctt      2520
     aagaacattg ttgagtgtct ctatggattc cgacaggaga ttctctgggt cttctttgca      2580
     tttctgttgt cagagtcatt ttaacctgtg tagctagtgg cattatattc tttggatttt      2640
     gtatgattaa agtacatgat tgtgaaaaaa aaaaaaaaaa aaaaaaaaaa                 2690
//


spacer
spacer