spacer

EBI Dbfetch

ID   BC051917; SV 1; linear; mRNA; STD; MUS; 3510 BP.
XX
AC   BC051917;
XX
DT   06-MAY-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus matrix metallopeptidase 17, mRNA (cDNA clone MGC:62154
DE   IMAGE:5716458), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3510
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3510
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAY-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 29f632a8142025c3d0f9e3af942cec8a.
DR   Ensembl-Gn; ENSMUSG00000029436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031390; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 114 Row: j Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543256.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3510
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FC0"
FT                   /clone="MGC:62154 IMAGE:5716458"
FT                   /tissue_type="Mouse, brain 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..3510
FT                   /gene="Mmp17"
FT                   /note="synonym: MT4-MMP"
FT   CDS             80..1816
FT                   /codon_start=1
FT                   /gene="Mmp17"
FT                   /product="matrix metallopeptidase 17"
FT                   /db_xref="GOA:Q9R0S3"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR016293"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:1346076"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0S3"
FT                   /protein_id="AAH51917.1"
FT                   /translation="MGRRPRGPGSPRGPGPPRPGPGLPPLLLVLALAAHGGCAAPAPRA
FT                   EDLSLGVEWLSRFGYLPPADPASGQLQTQEELSKAITAMQQFGGLETTGILDEATLALM
FT                   KTPRCSLPDLPPGAQSRRKRQTPPPTKWSKRNLSWRVRTFPRDSPLGRDTVRALMYYAL
FT                   KVWSDITPLNFHEVAGNAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGDHHTAGDTH
FT                   FDDDEPWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAPSSIMQPYYQGPVGDPLRYGL
FT                   PYEDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLPEPPNNRSSTPPQKDVPHRCTAHF
FT                   DAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDH
FT                   KIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAVFSWAHNDRTYFFKDQLYWRY
FT                   DDHTRRMDPGYPAQGPLWRGVPSMLDDAMRWSDGASYFFRGQEYWKVLDGELEAAPGYP
FT                   QSTARDWLVCGEPLADAEDVGPGPQGRSGAQDGLAVCSCTSDAHRLALPSLLLLTPLLW
FT                   GL"
FT   misc_difference 3458
FT                   /gene="Mmp17"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 3490..3510
FT                   /gene="Mmp17"
FT                   /note="polyA tail: 21 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3510 BP; 726 A; 1051 C; 1028 G; 705 T; 0 other;
     cgggcgcgga gccgagcgag gcgcggagct ggctgctggc gggtgcgggg accctcgcca        60
     cccgacctgg gagagcggga tgggacgccg cccgcgggga cctgggtccc cccggggacc       120
     tggccctcca cgccccgggc cggggctgcc accactgctg cttgtactgg cgctggcggc       180
     ccatgggggc tgcgcagcgc ccgcgccccg cgcggaggac ctcagcctcg gggtggagtg       240
     gctaagcagg tttggctacc tgccgcctgc agatccggca tcagggcagc tacagaccca       300
     ggaggaactg tccaaagcga ttactgccat gcagcagttt ggtggtctgg agaccactgg       360
     catcctagat gaggccactc tggccctgat gaaaacccct cgatgctccc ttccggacct       420
     gccccctggg gcccaatcga gaaggaagcg gcagactcca cccccaacca aatggagcaa       480
     gaggaacctt tcttggaggg tccggacatt cccacgggac tcacccctgg gccgggatac       540
     tgtgcgtgca ctcatgtact acgccctcaa agtctggagt gacatcacac ccttgaactt       600
     ccacgaggta gcgggcaacg cggcggacat ccagatcgac ttctccaagg ccgaccacaa       660
     tgacggctac cccttcgatg gccctggtgg cacggtggcc cacgcattct tccctggtga       720
     ccaccacacg gcaggggaca cccactttga tgacgatgag ccatggacct tccgttcctc       780
     agatgcccac gggatggacc tgtttgcagt ggccgtccat gagtttggtc atgccattgg       840
     tctgagccat gttgccgccc caagctccat catgcaaccg tactaccagg gccccgtggg       900
     tgacccgcta cgctatggac ttccctatga ggacagggtg cgtgtctggc agttgtacgg       960
     tgtgcgggaa tccgtgtccc ctactgccca gctggatacc ccagagcccg aggagccacc      1020
     cctcctgcca gagcccccca acaatcggtc tagcactccg ccccagaagg acgtgcctca      1080
     caggtgcact gcccactttg atgctgtggc ccagattcga ggcgaagcat tctttttcaa      1140
     aggcaagtat ttctggaggc tgacccggga ccgacacttg gtgtcgctgc agccggctca      1200
     aatgcatcgc ttctggcggg gcctgccgct gcacctggac agtgtggacg ccgtgtatga      1260
     gcgtaccagt gaccacaaga ttgtcttctt caaaggagac agatactggg tgtttaagga      1320
     caacaacgta gaggaagggt acccgcgacc tgtctccgac ttcagcctcc cgccaggtgg      1380
     catcgatgct gtcttctcct gggcccacaa tgacaggact tatttcttta aggaccagct      1440
     gtactggcgc tatgatgacc acacacggcg catggaccct ggctaccctg cccagggacc      1500
     cctgtggaga ggtgtcccca gcatgttgga tgatgccatg cgctggtctg atggtgcatc      1560
     ctatttcttc cgaggccagg agtactggaa agtgctggat ggcgagctgg aagcagcccc      1620
     cgggtaccca cagtctacag cccgcgactg gctggtatgc ggtgagccgc tggcggatgc      1680
     ggaggatgta gggcctggac cccagggccg cagtggggcc caagatggtc tggcagtatg      1740
     ttcctgcact tcagacgcac acaggttggc actgccatct ctgctgcttc tgactccact      1800
     gctgtggggc ctgtgaacct cagtctctgc caaggcatcc tgagggcagt gctagccttg      1860
     cggatcaagg agccaagggg agcagggaca cactggccag tactcagcag gacttgtgct      1920
     ccaagcttcc ggtccctcgc tccttccttc cttccttcct tgaacccagg ggtgctgtgc      1980
     catctgctgg agtggtctcc agctgggaca ggacgtccca ccaagggcat ccatgcacac      2040
     cttgcctacc tggagcagcc ataggcagct ccccttccct cctctgcaca tcatgctgct      2100
     tcgttgcacc ttgccgggct gcccaagccc agctgtcaca accccaggat gccttgtctg      2160
     cacctgagcg gctctgatgg catctgcacg tgggctgatg aggggcaaac aggggttcct      2220
     cgtggtatcc gtaggggcca ccatgcctgt ttcacaagta agagagttga tgccccgatg      2280
     ggggaacagg gtgggagaaa ggcacctacc cagaagtctg atccactgcc gtttgcagca      2340
     gccagcgccg tatctgctgg gataggggac cagtcacact caggatctgc ccacagattc      2400
     ccagatgctg gccaggggcc ttgctccaac caccaggagc acagccacct ctccccgtcc      2460
     tagataggtt agccatggag gctgtgtcct gttatctccc tctctttggc caggagagca      2520
     ttgtgggtct ccctcgggtg ctgttgatgg gggtgggggg cgcccataga gatatttctt      2580
     catctgtcag tacccattgc ttcagcaaga tgcccccata tagttctggc ctgagaccct      2640
     gcagcttgga ctcacagctg tcccctcccc agctgcagaa gggcttctaa cacctggaat      2700
     aaaggtgggc gttcagttta gggaaggagg atggttgggg gagcccaggg tgatagcaag      2760
     ggggagctgc agggataagt gtcagggtcc tcggggagtc atgacaatgt taccgcctaa      2820
     cttggagatg taggagctgt gcacggattg cttctctggg tgacaaacct ccatggtcca      2880
     gaaaggggct gaggttgaac ccaagatggg ttaatgagct ccagaaagga acagccaagt      2940
     tcaaaggttc tgggacaaga cgggcctgag gaacagggcc acccaggtag gcgtggctgt      3000
     agggtaagca gtttctgtca ttgggcacga gatgaaaatt agtgatcaca cgcacatacc      3060
     cccctcccca actggcccgg tcccatctca ggtaagaaag gcttctgtct accccaggcc      3120
     aggtttgagt gttgtcagga tgagtgagca gctagcgggg cctaagtttc taccctccat      3180
     ttcccaagcc tggccacacc ctagacccac ctgtcagact aggcaggaca gagtcagggg      3240
     taggggcatc tgaggtttcc ctgtcttgga agccacccta ctctgccctc atatcaaagc      3300
     acgctcctat gatgtcccat gttgtccacc agcctgcagg acacagatgt cctatacagc      3360
     aacagggaag ggtccaaaaa tctttgtcac atagcactga aagccaggcc cgcaggctgg      3420
     agctgtctag atgctggtgt cacactcatt ttaaaactca aactcttaat aaaaattttg      3480
     tacactggaa aaaaaaaaaa aaaaaaaaaa                                       3510
//


spacer
spacer