Dbfetch

ID   BC051679; SV 1; linear; mRNA; STD; MUS; 2444 BP.
XX
AC   BC051679;
XX
DT   06-MAY-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus insulin-like growth factor 2 mRNA binding protein 1, mRNA
DE   (cDNA clone MGC:60613 IMAGE:30008106), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2444
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2444
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (30-APR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; be35479ffe4ea5b81dceee8c7584365e.
DR   Ensembl-Gn; ENSMUSG00000013415; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018993; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018961; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018931; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018934; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018748; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019386; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018302; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018719; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018827; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018816; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018897; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018843; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019426; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018073; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018351; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000013559; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031867; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0031811; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0031796; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031800; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031597; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032319; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031381; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0031512; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0031651; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0031643; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0031771; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031626; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032340; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031099; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031076; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Kenneth R. Boheler (National Insitute on
CC   Aging, USA)
CC   cDNA Library Preparation: Yulan Piao and Minoru Ko (National
CC   Institute on Aging, NIH: http://lgsun.grc.nia.nih.gov/cDNA/)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 111 Row: e Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31560605.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2444
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="129/Sv x 129/Sv-CP"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIA Mouse Undifferentiated ES Cell cDNA Library
FT                   (Long)"
FT                   /clone="MGC:60613 IMAGE:30008106"
FT                   /tissue_type="ES Cell, undifferentiated, mouse, R1
FT                   Embryonic stem cells"
FT                   /note="Vector: pSPORT1"
FT                   /db_xref="taxon:10090"
FT   gene            1..2444
FT                   /gene="Igf2bp1"
FT                   /note="synonyms: CRD-BP, IMP-1, Neilsen"
FT   CDS             295..2028
FT                   /codon_start=1
FT                   /gene="Igf2bp1"
FT                   /product="insulin-like growth factor 2 mRNA binding protein
FT                   1"
FT                   /db_xref="GOA:O88477"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR034837"
FT                   /db_xref="InterPro:IPR034842"
FT                   /db_xref="MGI:MGI:1890357"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88477"
FT                   /protein_id="AAH51679.1"
FT                   /translation="MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCP
FT                   DEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQY
FT                   GTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQITQGP
FT                   ENGRRGGFGSRGQPRQGSPVAAGAPAKQQPVDIPLRLLVPTQYVGAIIGKEGATIRNIT
FT                   KQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADGVPLKI
FT                   LAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAE
FT                   QEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSF
FT                   MQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVVITG
FT                   PPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLT
FT                   AAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNLAQARR
FT                   K"
FT   misc_difference 1121
FT                   /gene="Igf2bp1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'G' in cDNA, 'E' in the mouse genome."
FT   misc_difference 2387
FT                   /gene="Igf2bp1"
FT                   /note="'T' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2393..2444
FT                   /gene="Igf2bp1"
FT                   /note="polyA tail: 52 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2444 BP; 645 A; 698 C; 666 G; 435 T; 0 other;
     cagcccgctc gcaggggttt cggaccgaag ggaaggagcc gcgccgcgtc gtcgtcagcc        60
     tcccctgcac tcggcgggca cttctcccgg gctcacccaa actctcccgt gacccccgcg       120
     tgccctcagg ccgcccaccc gcccggagct ccggacaact tcaggggtgg ggtgcgtaga       180
     aagtttgcgg ctcccgccgc ccgtctccac gcctctcggc ctaggaggct ctccgcccgc       240
     gcccgcccgg ctcggccttg cctggaaccg tgtccttgcc ccgccaccgc caccatgaac       300
     aagctttaca tcggcaacct caacgagagt gtgacccccg cagacttgga gaaagtattc       360
     gcggagcaca agatctccta cagcggccag ttcttggtca aatccggcta cgccttcgtg       420
     gattgccccg acgagcactg ggcgatgaag gccatcgaaa ctttctcggg gaaagtagaa       480
     ctgcaaggaa aacgtctaga gattgaacac tcagtcccca aaaaacaaag gagtcggaaa       540
     atacagatcc gcaatattcc acctcagctc cgatgggaag tgctagatag cctgctggct       600
     cagtacggta cagtggagaa ctgtgagcaa gtgaacactg aaagtgagac agctgtggtc       660
     aacgtcacct actctaaccg ggagcagacc aggcaagcta tcatgaagct aaatggccat       720
     caactggaga accatgccct gaaggtctcc tacatacctg atgagcagat aacgcaaggt       780
     cctgagaatg ggcgtcgtgg aggctttggg tctcggggcc agccccggca agggtcgccc       840
     gtggcagcag gggctccagc caagcagcag ccagtggaca tccctctccg gctcctggtg       900
     cctacgcagt atgtaggcgc tatcattggc aaggagggtg ccaccatccg aaacatcaca       960
     aaacagacgc agtccaaaat agacgtgcat aggaaggaga atgcgggcgc tgcggagaag      1020
     gccatcagcg tgcattcaac ccctgaaggc tgctcctccg cgtgcaagat gatcttggag      1080
     attatgcaca aggaggcaaa ggacaccaaa acggcagatg gagttcccct gaagatcctg      1140
     gctcataaca acttcgtcgg gcgactcatt ggcaaggaag ggcggaacct gaagaaggtg      1200
     gagcaggaca cagagacgaa gatcaccatc tcatcgctcc aggacctcac gctctataac      1260
     cctgagagga ccatcactgt gaagggcgcc attgagaact gttgcagggc cgagcaggag      1320
     atcatgaaga aagttcgaga ggcttacgag aacgacgtgg ccgccatgag cttgcagtcc      1380
     cacctcatcc ctgggcttaa cctggctgct gtaggtctct tcccagcttc atccagcgct      1440
     gtccctcctc ctcccagcag tgtcaccggg gctgctccct atagctcctt catgcaggct      1500
     ccggagcagg agatggtaca agtgttcatc cccgcccagg ctgtgggcgc catcattggc      1560
     aagaagggcc agcacatcaa acaactctcc cgcttcgcca gcgcctccat caagattgca      1620
     ccaccagaaa cacctgactc caaagttcga atggtcgtca tcactggacc cccagaggct      1680
     cagttcaagg cccagggaag aatctatggc aaactaaaag aagagaattt ctttggtccc      1740
     aaggaggaag taaagctaga gacccacata cgggttccgg cttcagcagc cggccgtgtc      1800
     atcggcaaag gcggcaaaac ggtgaatgag ctgcagaact tgaccgcagc tgaggtggta      1860
     gtgccaagag accagacccc ggatgagaac gaccaagtca ttgttaagat catcggacat      1920
     ttctatgcca gccagatggc tcagcggaag atccgagaca tcctggctca agttaagcaa      1980
     cagcaccaga agggacagag caacctggcc caggctcgga ggaagtgacc ccgccccctc      2040
     ctgtcccatt ggctccaaga tcagcaggag gaacacagaa ctggaggggc gggtggaggg      2100
     ccggtgtgct cttcccagca ggcctgagaa tgagtgggaa tcagggcatt tgggcctggc      2160
     tggagatcag gtttgcacac tgtcttgaga acaatgttcc agtgaggaat cctgatctct      2220
     cgcccccaat tgagccagct ggccacagcc caccccttgg aatatcacca ttgcaatcat      2280
     agcttgggtt gcttttaaac gtggattgtc ttgaagttct ccagcctcca tggaaggatg      2340
     ggtcagatcc cagtggggaa gagaaataaa atttccttca ggttttttaa aaaaaaaaaa      2400
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaa                       2444
//