spacer

EBI Dbfetch

ID   BC050914; SV 1; linear; mRNA; STD; MUS; 4137 BP.
XX
AC   BC050914;
XX
DT   12-APR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus AXL receptor tyrosine kinase, mRNA (cDNA clone MGC:63240
DE   IMAGE:6418252), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4137
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4137
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (09-APR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0e0993a2f4dc277f1d27ca795d15eb4d.
DR   Ensembl-Gn; ENSMUSG00000002602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002677; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4137
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FI0"
FT                   /clone="MGC:63240 IMAGE:6418252"
FT                   /tissue_type="Brain, enriched mouse brain 12.5dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4137
FT                   /gene="Axl"
FT                   /note="synonyms: Ark, Tyro7"
FT   CDS             64..2730
FT                   /codon_start=1
FT                   /gene="Axl"
FT                   /product="AXL receptor tyrosine kinase"
FT                   /db_xref="GOA:Q00993"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:1347244"
FT                   /protein_id="AAH50914.1"
FT                   /translation="MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLT
FT                   GTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLS
FT                   DAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPV
FT                   TLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRP
FT                   HHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQV
FT                   SVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNG
FT                   SQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVS
FT                   VTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLGALVAAACV
FT                   LILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELK
FT                   EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDF
FT                   LSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQP
FT                   VFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG
FT                   DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIY
FT                   DYLRQGNRLKQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENTLKALPPAQEPDE
FT                   ILYVNMDEGGSHLEPRGAAGGADPPTQPDPKDSCSCLTAADVHSAGRYVLCPSTAPGPT
FT                   LSADRGCPAPPGQEDGA"
FT   misc_difference 3968
FT                   /gene="Axl"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 4120..4137
FT                   /gene="Axl"
FT                   /note="polyA tail: 18 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4137 BP; 954 A; 1121 C; 1083 G; 979 T; 0 other;
     gcgaggtgcc catcaacttc ggaagaaagt ttggcatcaa tctgagctgt tggtgtctgg        60
     aggatgggca gggtcccgct ggcctggtgg ttggcgctgt gctgctgggg gtgtgcagcc       120
     cataaggaca cacagaccga ggctggcagc ccgtttgtgg ggaacccagg gaatatcaca       180
     ggtgccagag gactcacggg gacacttcgg tgtgagctcc aggttcaggg ggaaccccct       240
     gaggtggtgt ggcttcgaga tggacagatc ctagaactgg ctgataacac ccagacccag       300
     gtgcctctgg gcgaagactg gcaagatgaa tggaaagttg tcagtcagct cagaatctca       360
     gccctgcaac tttcagatgc aggggagtac cagtgtatgg tgcatctaga aggacggacc       420
     tttgtgtctc agccgggctt tgtagggctg gaaggtctcc cgtacttcct ggaggagcct       480
     gaggacaaag ctgtgcctgc caacacccct ttcaacctaa gctgccaggc ccagggaccc       540
     ccggaacccg tgaccctact ctggcttcaa gatgctgtcc ccctggcccc agtcacagga       600
     cacagctccc agcacagtct gcaaactcca ggcctgaaca agacatcttc tttctcatgt       660
     gaagcccaca atgccaaggg agtcaccacc tcccgcacag ccaccatcac agtgctcccc       720
     cagaggcctc accatctcca cgtggtttcc agacaaccta cggagctaga ggtagcttgg       780
     acccctggcc tgagtggcat ctacccgctc acccactgca acctgcaggc cgtgctgtca       840
     gacgatgggg tgggtatctg gctgggaaag tcagatcctc ctgaagaccc cctcaccttg       900
     caagtatcag tgccccccca ccagcttcgg ctggaaaagc tccttcctca caccccgtat       960
     cacatccgga tatcctgcag cagcagccag ggcccctcac cttggaccca ctggcttcct      1020
     gtggagacca cagagggagt gcccttgggt ccccctgaga acgttagcgc catgcggaat      1080
     gggagccagg tcctcgtgcg ttggcaggag ccaagggtgc ccctgcaagg caccctgtta      1140
     gggtaccggc tggcatatcg aggccaggac acccccgagg tacttatgga tatagggcta      1200
     actcgagagg tgaccttgga actgcggggg gacaggcctg tggctaacct gactgtgtct      1260
     gtgacagcct atacctcggc tggggatggg ccctggagcc ttcctgtgcc cctagagccc      1320
     tggcgcccag ggcaaggaca gccactccac catctggtga gtgaaccccc acctcgcgcc      1380
     ttctcgtggc cttggtggta tgtactgctg ggagcacttg tggctgccgc ctgcgtcctc      1440
     atcttggccc tgttccttgt ccatcggagg aagaaggaga ctcgatatgg ggaggtgttt      1500
     gagccaaccg tggaaagagg tgaactggta gtcaggtacc gtgtccgaaa gtcctacagc      1560
     cggcggacca ctgaagccac cttgaacagt ctgggcatca gtgaagagct gaaggagaaa      1620
     ctacgagacg tcatggtaga tcggcataag gtggccttgg ggaagaccct gggagaagga      1680
     gaatttggcg ctgtgatgga aggtcagctc aatcaggatg actccatcct caaggtcgct      1740
     gtgaagacca tgaaaattgc catctgcaca agatcagagc tggaggattt cctgagtgaa      1800
     gctgtctgca tgaaggaatt tgaccacccc aacgtcatga ggctcattgg cgtctgtttt      1860
     cagggctctg acagagaggg tttcccagaa cctgtggtca tcttgccttt catgaaacac      1920
     ggagacctac acagtttcct cctgtactcc cggctcgggg accagccagt gttcctgccc      1980
     actcagatgc tagtgaagtt catggccgac attgccagtg gtatggagta cctgagtacc      2040
     aagagattca tacatcggga cctggctgcc aggaactgca tgctgaatga gaacatgtcc      2100
     gtgtgtgtgg cagacttcgg gctctccaag aagatctaca acggggatta ctaccgccaa      2160
     gggcgcattg ccaagatgcc agtcaagtgg attgctattg agagtctggc agatcgggtc      2220
     tacaccagca agagcgatgt gtggtccttc ggtgtgacaa tgtgggagat cgccacccga      2280
     ggccaaactc cctatccagg ggtggagaac agtgagattt acgactacct gcgtcaagga      2340
     aatcggctga aacagcctgt ggactgtctg gacggcctgt atgccctgat gtctcggtgc      2400
     tgggaactga accctcgaga ccggccaagt tttgcggagc tccgggaaga cttggagaac      2460
     acactgaagg ctctgccccc tgctcaggag ccagatgaaa tcctctatgt caacatggat      2520
     gagggcggaa gccaccttga accccgtggg gctgctggag gagctgaccc cccaacccaa      2580
     cctgatccta aggattcctg tagctgtctc actgcagctg acgtccactc agctggacgc      2640
     tatgtccttt gtccttctac agccccagga cccactctgt ctgctgacag aggctgccca      2700
     gcacctccag ggcaggagga cggagcctga gacaatcttc cacctgggac atcctctcag      2760
     gacccaagct aggcactgcc actgggggaa agctcacccc cccactccgt cactccaggc      2820
     cttctcccca gatgcagaat ggccttccct cccttctcag atgcagtcca tgccttatgc      2880
     accctatcca taacagtttc aagggatcgt ctcacatctt ccatcccagc gttctagatt      2940
     ttaaggtttg agtttagagt tcaaagttct caaagatgat gagtctttgg accgagatgc      3000
     ttgtttctag gtctgcagcg ctgttgctat agacaggccc actgctcgaa ggctctgaga      3060
     ttctatggct ctagattttt ctggctctat aattcgtggc aatgctccca tggttttagg      3120
     ttgcacgact ctgagattcc aggacctaag gcttctagac tttatttttc tggagccagg      3180
     ggtcctgtca gtggaagatt gtagattttt aaattctaaa gattctaggc atgaaggttc      3240
     taaggcatac tgcttctcca gtttaacagt ttagggctca tgttggaata ctccagatca      3300
     taatgtttca aacttttatt ttttttaatt tctaagaccc cagtgatggt caactacaga      3360
     ttctgaagcc ttatgaccat agattctttt atataaaaat cctgtatctc aaggaaatat      3420
     gattctagac tctgaaattc caaagcttta agagtctcca gatggagttt ctaagctatg      3480
     atgtggtgat aatctaaagt ttagtccaag gttctagatt cctaagcttc cacgtcatct      3540
     gctcccagga ttccagatta ttaaactcta aaactctaat gttggcctga tcttcgtctc      3600
     aggccctgta ggatgctgtg ggtcctcagc atctaagtca caagaggctc cagttaacga      3660
     ggactaatga gacaccaaag ttctaaccac ttctaatgct ggacacctct aggttctatg      3720
     ctgctttttg cctttctagc acataattaa atgcccaaga atacatatgt ctaaagatct      3780
     taaatctcta agcactatgg agccaatgtt ttgagtgtct gagattctaa aggtccacag      3840
     tctagagtat taggtacgac tccaagggtg ggcgcttgta gccatcctaa gtcctttccc      3900
     tccttaagca cctatgctcc tcctctcctt gtgtggggta caccccacct taagcctgtg      3960
     cgatgcattg ggaatgcctg ctttcctcca agggatgggt catctcccct catttggggc      4020
     catgttgccc cttgagccag tcccctatgc ctgttctgaa gtgtggactc tggtgcctcc      4080
     agagaggctc agatcacata aaacttttgt cagtcactaa aaaaaaaaaa aaaaaaa         4137
//


spacer
spacer