Dbfetch

ID   BC050885; SV 1; linear; mRNA; STD; MUS; 2934 BP.
XX
AC   BC050885;
XX
DT   12-APR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus opioid receptor-like 1, mRNA (cDNA clone MGC:63231
DE   IMAGE:5703258), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2934
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2934
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (09-APR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 34e2c6edcf21fb138d70f951ea5c7e57.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027036; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027002; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026972; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027010; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026752; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026866; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026832; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025947; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026283; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184127; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059957; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059991; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059927; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059607; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060383; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059899; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059579; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059686; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059797; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059651; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059467; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058879; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543372.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2934
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EW0"
FT                   /clone="MGC:63231 IMAGE:5703258"
FT                   /tissue_type="Brain, mouse 15.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2934
FT                   /gene="Oprl1"
FT                   /note="synonyms: KOR3, ORL1, MOR-C, XOR1, LC132, morc,
FT                   Oprl"
FT   CDS             170..1273
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /product="opioid receptor-like 1"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAH50885.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGCKTSETVPRPA"
FT   misc_difference 2913..2934
FT                   /gene="Oprl1"
FT                   /note="polyA tail: 22 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2934 BP; 647 A; 738 C; 735 G; 814 T; 0 other;
     gccattccca gccggagcag accccaagct agagtgagaa gcattactca gttcattgtg        60
     ctcctgcctg cctttctgct aagcattagg gtctgttttg gcccagcttc tgaagaggtt       120
     gtgtgtgctg ttggaggaac tgtactgagt ggctttgcag ggtgacagca tggagtccct       180
     ctttcctgcc ccattctggg aggtcttgta tggcagccac tttcaaggga acctgtctct       240
     cctaaatgag accgtacccc atcacctgct cctcaatgct agccacagtg ccttcctgcc       300
     ccttggactc aaggtcacca tcgtggggct ctacttggct gtgtgcatcg gggggctcct       360
     ggggaactgc ctcgtcatgt atgtcatcct caggcacacc aagatgaaga ctgctaccaa       420
     catttacata tttaatctgg cactggctga taccctggtc ttgctgacac tgcccttcca       480
     gggcacagac atccttctgg gcttctggcc atttgggaat gcactgtgca agacggtcat       540
     tgctatcgac tactacaaca tgtttaccag cactttcact ttgactgcca tgagtgtaga       600
     ccgttatgta gctatctgcc accctatccg tgcccttgat gttcggacat ccagtaaagc       660
     ccaggccgtt aatgtggcca tatgggccct ggcttcggtg gttggtgttc ctgttgccat       720
     catgggctca gcacaagtgg aggatgaaga gatcgagtgc ctggtggaga tccccgcccc       780
     tcaggactat tggggccctg tatttgccat ctgcatcttc cttttttcct tcatcatccc       840
     ggttctgatc atctctgtct gctacagcct catgattcga cgacttcgtg gtgtccggct       900
     gctttcaggc tcccgagaga aggaccggaa cctgcgacgc atcacacggc tggtactggt       960
     agttgtggct gtgtttgtgg gctgctggac acctgtgcag gtctttgtcc tggttcaagg      1020
     actgggtgtt cagccaggta gtgagactgc agtagccatt ctgcgcttct gcacagccct      1080
     gggctatgtc aacagttgtc tcaatcccat tctctatgct ttcttggatg agaacttcaa      1140
     ggcctgcttt agaaagttct gctgtgcttc tgccctgcac cgggagatgc aggtttctga      1200
     tcgtgtgcgc agcattgcca aggatgtagg ccttggttgc aagacctctg agacagtacc      1260
     acggccggca tgactaggcg tggacctgcc catggtgcct gtcagtccac agagcccatc      1320
     tacacccaac acggagctca cacaggtcac tgctctctag gttgaccctg aactgagcgt      1380
     ctggggcctt gaatggcttt tcttttggtt caggatgctc agtcctagag gaagaccttt      1440
     tagcaccatg ggacaggtca aagcatcaag gtggcctcca tggcctctgt cagattaagt      1500
     ttcctccctg gtataggacc agagagaacc aaaggaactg catggaaaca tccacaactc      1560
     agtggacatg cctggtgaac ccatgtaggt attcatggtt cacttgactc ttctctggtt      1620
     tctccctgct gccctggttc taggtgggct cagcctgagg tattgtagtt gtcatgtagt      1680
     cactattgtg actacctgtt gtgtgctatt gccctcagcc tttcagtgtt tgcacagaac      1740
     tggtgatcat acccagtgtt gcctggccct taagcttgga gttgccttgg agcatctagt      1800
     tctgactcca ctgatgcatt cagattacct gaggtgggtg agcatcagtg ggttcttgga      1860
     tgactgtttc ctgacgattc ttttcatgct gtactatgga gtatatgaag gggacttcac      1920
     acttcatctg gtactgccac tgcctgctct accaacctgg accaccttct cagcaagagg      1980
     ctagcagggg gacaagacac aaagcttccc taaggctctt tccctccaaa accactgtga      2040
     actcttattc tacagactgt ttggcaagcc ctgcttctaa ctgtgtggga agtaatcagg      2100
     agaaaattct gtggcctctg taggctgctc acagcatgga ggcaccacat gctggtcttg      2160
     ggtatgtgtc ttggctgctc agtatgggca gggcagggca cgagactatg ctctctcctt      2220
     attctccaca gcctccctca gctctccagc agtcgctctt ttacttgaca gtagaggtca      2280
     gcagttgtac tgctagaaac acacttgtag cccgggaaga ctggagtcag gatgtgttct      2340
     attctatacc cacagtgacc acctgcttca tttatagggt taggacatat ccaagcaagg      2400
     cctgggcttg gcatcaaatg aagagctggt atgagagctg aagcctaaaa tggctcattt      2460
     gagccaatct gcaaggacta ttacggtttt ggggacattg gaagaagagt cgataccttg      2520
     gagatatatt gttggttcac agaagaagag gctttgtaaa tgccctttct atgggtcaga      2580
     taaaaaaata ccagcaacct tggatagaat ctgatcttac acagagacct tggttaggtg      2640
     gtttcatgcc atgcagaacc caggctggtt cctgtctcag agagacctgg ccttaacaat      2700
     ctttctgggg agaccagggt tctttcaatg acacttgtgc aggagccatt agctctagtg      2760
     ttttcttgct aatgctagaa actttgtgaa tttgtatatc tttatgtatt taagcatgca      2820
     acaaatgtca ttttcgtgca tgtagctagc cctgaacctg cctctggggt aatgaaggag      2880
     ttctcataat aaacacttac cagtgaccag taaaaaaaaa aaaaaaaaaa aaaa            2934
//