Dbfetch

ID   BC050601; SV 1; linear; mRNA; STD; HUM; 2071 BP.
XX
AC   BC050601;
XX
DT   23-APR-2003 (Rel. 75, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation
DE   protein, theta polypeptide, mRNA (cDNA clone MGC:60050 IMAGE:6501365),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2071
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2071
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-APR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 92d2750069d9b90003dd62a251050f6f.
DR   Ensembl-Gn; ENSG00000134308; homo_sapiens.
DR   Ensembl-Tr; ENST00000238081; homo_sapiens.
DR   Ensembl-Tr; ENST00000381844; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 110 Row: o Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21464103.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2071
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_71"
FT                   /clone="MGC:60050 IMAGE:6501365"
FT                   /tissue_type="Uterus, leiomyosarcoma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..2071
FT                   /gene="YWHAQ"
FT                   /note="synonyms: HS1, 1C5"
FT   CDS             11..748
FT                   /codon_start=1
FT                   /gene="YWHAQ"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, theta polypeptide"
FT                   /db_xref="GOA:P27348"
FT                   /db_xref="H-InvDB:HIT000259152.13"
FT                   /db_xref="HGNC:HGNC:12854"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="PDB:2BTP"
FT                   /db_xref="PDB:5IQP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27348"
FT                   /protein_id="AAH50601.1"
FT                   /translation="MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLS
FT                   VAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKY
FT                   LIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPT
FT                   HPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLR
FT                   DNLTLWTSDSAGEECDAAEGAEN"
FT   misc_difference 2058..2071
FT                   /gene="YWHAQ"
FT                   /note="polyA tail: 14 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 2071 BP; 610 A; 419 C; 428 G; 614 T; 0 other;
     cgcgcccgcc atggagaaga ctgagctgat ccagaaggcc aagctggccg agcaggccga        60
     gcgctacgac gacatggcca cctgcatgaa ggcagtgacc gagcagggcg ccgagctgtc       120
     caacgaggag cgcaacctgc tctccgtggc ctacaagaac gtggtcgggg gccgcaggtc       180
     cgcctggagg gtcatctcta gcatcgagca gaagaccgac acctccgaca agaagttgca       240
     gctgattaag gactatcggg agaaagtgga gtccgagctg agatccatct gcaccacggt       300
     gctggaattg ttggataaat atttaatagc caatgcaact aatccagaga gtaaggtctt       360
     ctatctgaaa atgaagggtg attacttccg gtaccttgct gaagttgcgt gtggtgatga       420
     tcgaaaacaa acgatagata attcccaagg agcttaccaa gaggcatttg atataagcaa       480
     gaaagagatg caacccacac acccaatccg cctggggctt gctcttaact tttctgtatt       540
     ttactatgag attcttaata acccagagct tgcctgcacg ctggctaaaa cggcttttga       600
     tgaggccatt gctgaacttg atacactgaa tgaagactca tacaaagaca gcaccctcat       660
     catgcagttg cttagagaca acctaacact ttggacatca gacagtgcag gagaagaatg       720
     tgatgcggca gaaggggctg aaaactaaat ccatacaggg tgtcatcctt ctttccttca       780
     agaaaccttt ttacacatct ccattcctta ttccacttgg atttcctata gcaaagaaac       840
     ccattcatgt gtatggaatc aactgtttat agtcttttca cactgcagct ttgggaaaac       900
     ttcattcctt gatttgtgtt tgtcttggcc ttcctggtgt gcagtactgc tgtagaaaag       960
     tattaatagc ttcatttcat ataaacataa gtaactccca aacacttatg tagaggacta      1020
     aaaatgtatc tggtatttaa gtaatctgaa ccagttctgc aagtgactgt gttttgtatt      1080
     actgtgaaaa taagaaaatg tagttaatta caatttaaag agtattccac ataacttctt      1140
     aatttctaca ttccctccct tactcttcgg gggtttcctt tcagtaagca acttttccat      1200
     gctcttaatg tattcctttt tagtaggaat ccggaagtat tagattgaat ggaaaagcac      1260
     ttgccatctc tgtctagggg tcacaaattg aaatggctcc tgtatcacat acggaggtct      1320
     tgtgtatctg tggcaacagg gagtttcctt attcactctt tatttgctgc tgtttaagtt      1380
     gccaacctcc cctcccaata aaaattcact tacacctcct gcctttgtag ttctggtatt      1440
     cactttacta tgtgatagaa gtagcatgtt gctgccagaa tacaagcatt gcttttggca      1500
     aattaaagtg catgtcattt cttaatacac tagaaagggg aaataaatta aagtacacaa      1560
     gtccaagtct aaaactttag tacttttcca tgcagatttg tgcacatgtg agagggtgtc      1620
     cagtttgtct agtgattgtt atttagagag ttggaccact attgtgtgtt gctaatcatt      1680
     gactgtagtc ccaaaaaagc cttgtgaaaa tgttatgccc tatgtaacag cagagtaaca      1740
     taaaataaaa gtacatttta taaaccattt actatggctt tgtaacaatt gcatacccat      1800
     attttaaggg acaggtgaat ttactacttt ctaaagttta ttgatacttc ccttttatgt      1860
     aaaatgtagt agtgatacct atatttccac attgtgcatt gtgacacact tgtctaggga      1920
     tgcctggaag tgtataaaat tggactgcat ttcttagagt gttttactat agatcagtct      1980
     catgggccat ctcttcctca gatgtaaatg atatctggtt aagtgttata tggaataaag      2040
     tggacatttt aaaactaaaa aaaaaaaaaa a                                     2071
//