spacer

EBI Dbfetch

ID   BC050187; SV 1; linear; mRNA; STD; MUS; 1663 BP.
XX
AC   BC050187;
XX
DT   04-APR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus G protein-coupled receptor 19, mRNA (cDNA clone MGC:60649
DE   IMAGE:30020126), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1663
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1663
RA   Strausberg R.;
RT   ;
RL   Submitted (02-APR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 172157e8e6b2adfe3f875c3de5d063ee.
DR   Ensembl-Gn; ENSMUSG00000032641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046255; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116515; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165392; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Minoru Ko
CC   cDNA Library Preparation: Yulan Piao and Minoru Ko (National
CC   Institute on Aging, NIH: http://lgsun.grc.nia.nih.gov/cDNA/)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 111 Row: k Column: 8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1663
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIA Mouse 7.5-dpc Whole Embryo cDNA Library
FT                   (Long)"
FT                   /clone="MGC:60649 IMAGE:30020126"
FT                   /tissue_type="Embryo, whole, mouse, 7.5-dpc"
FT                   /note="Vector: pSPORT1"
FT                   /db_xref="taxon:10090"
FT   gene            1..1663
FT                   /gene="Gpr19"
FT   CDS             344..1591
FT                   /codon_start=1
FT                   /product="Gpr19 protein"
FT                   /db_xref="GOA:Q61121"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:892973"
FT                   /protein_id="AAH50187.1"
FT                   /translation="MVFAHRMDNDQPPVVTATLLVPLQNSSCAEAAEALLPHGLMGLHE
FT                   EHSWMSNRTELQYELNPGEVATASIFFGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFV
FT                   VSMACADLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICIDR
FT                   FYTIVYPLSFKVSREKAKKMIAASWILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEGTA
FT                   YTVIHFLVGFVIPSILIILFYQKVIKYIWRIGTDGRTLRRTMNIVPRTKVKTVKMFLLL
FT                   NLVFLFSWLPFHVAQLWHPHEQGYKKSSLVFTAVTWVSFSSPASKPTLYSIYNANFRRG
FT                   MKETFCMSSMKCYRSNAYTITTSSRMAKRNYVGISEIPPVSRTITKDSIYDSFDREARE
FT                   KKLAWPINSNPPNTFV"
FT   misc_feature    587..1333
FT                   /note="7tm_1; Region: 7 transmembrane receptor (rhodopsin
FT                   family)"
XX
SQ   Sequence 1663 BP; 387 A; 457 C; 413 G; 406 T; 0 other;
     atggtttagc agtgaacctt cacagcgtca tcttctctct ctaccaggaa gcaggctgag        60
     ggctgaggga aggcaaaggg gagatatgaa tgtgttccga aggtttcccg gtggctcatg       120
     gcatcctcca aagtcctgcc tgcgagctgt tcctgaccaa gaaaacccgc ggagcctgac       180
     tctgaaatcc agtcccgatg aagaggaggt gatattcatg tgtcctggct cacacgtgaa       240
     gcagagggct tcttggagtt ggttcttccc tttccccttt attcagttct ggcaatggaa       300
     ctcaagtgtc caggctttca gaactaagtg gaaaagagtg actatggttt ttgctcacag       360
     aatggataac gaccagccgc ctgtggtgac tgccaccctg ctggtgcccc ttcagaacag       420
     cagctgcgcg gaagcagctg aggccctgct gccccatggc ctgatgggat tgcatgagga       480
     gcacagctgg atgagcaaca ggacagagct tcagtacgag ctgaaccctg gagaggtggc       540
     caccgccagc atcttctttg gcgctttgtg gttgttctcc atctttggca attccctggt       600
     atgtctggtc atccaccgga gccggaggac tcagtccacc accaactact tcgtggtgtc       660
     catggcgtgt gctgaccttc tcatcagcgt ggccagcacg ccgtttgtcg tgctgcagtt       720
     caccaccggg aggtggaccc tgggtagcgc catgtgcaag gtggtccgct acttccagta       780
     cctcaccccc ggcgtgcaga tctacgtgct gctctccatc tgcatcgacc gcttctatac       840
     catcgtctac ccgctgagct tcaaggtgtc ccgagagaag gccaagaaaa tgattgcagc       900
     ctcctggatc ttggacgcgg ccttcgtgac gcctgtcttc tttttctacg gctctaactg       960
     ggatagtcac tgtaactact tcctccctcc ctcctgggag ggaactgcct ataccgtcat      1020
     ccacttcttg gtgggcttcg tgattccctc catcctcata atcctgtttt accagaaggt      1080
     cataaagtat atctggagaa taggcacgga cgggcggacg ctgagaagga cgatgaacat      1140
     tgtccccagg acaaaggtga aaacggtcaa gatgttcctg ctcttgaacc tagtgttcct      1200
     gttctcctgg ctacctttcc atgtggctca gctctggcat ccccatgagc aaggctacaa      1260
     gaagagctcc cttgtcttca cggcagtcac gtgggtatct ttcagctctc cagcctcgaa      1320
     acccactctg tactctattt ataatgccaa ttttcggaga gggatgaaag agacattctg      1380
     catgtcctcg atgaaatgct accgcagcaa tgcctacacc atcacgacca gttcacggat      1440
     ggccaaaaga aactatgtgg gcatttcgga aatccctccc gtgagcagga ccataaccaa      1500
     agactccatc tatgactcat ttgaccggga ggccagggag aagaagctcg cctggcccat      1560
     caactcaaac cctccaaaca cttttgtctg atttctaaga agtctttcac tgttatgtgc      1620
     cagagattaa aaagctttca ctataaaaaa aaaaaaaaga aaa                        1663
//


spacer
spacer