Dbfetch

ID   BC050005; SV 1; linear; mRNA; STD; MUS; 1198 BP.
XX
AC   BC050005;
XX
DT   02-APR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus arginase, liver, mRNA (cDNA clone MGC:58976 IMAGE:3990246),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1198
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1198
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1d1af443f7ffcb165b5a07bed3a9b569.
DR   Ensembl-Gn; ENSMUSG00000019987; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020161; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 108 Row: b Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1198
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="MGC:58976 IMAGE:3990246"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1198
FT                   /gene="Arg1"
FT                   /note="synonyms: PGIF, AI, arginase I"
FT   misc_difference 61
FT                   /gene="Arg1"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
FT   misc_difference 80
FT                   /gene="Arg1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 98
FT                   /gene="Arg1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   CDS             117..1088
FT                   /codon_start=1
FT                   /gene="Arg1"
FT                   /product="arginase, liver"
FT                   /db_xref="GOA:Q61176"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="MGI:MGI:88070"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61176"
FT                   /protein_id="AAH50005.2"
FT                   /translation="MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEY
FT                   DVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLA
FT                   VGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFS
FT                   WVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGR
FT                   KKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPT
FT                   LGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK"
FT   misc_difference 224
FT                   /gene="Arg1"
FT                   /note="'T' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1025
FT                   /gene="Arg1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1142
FT                   /gene="Arg1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1196..1198
FT                   /gene="Arg1"
FT                   /note="3 bases at the 3' end do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1198 BP; 341 A; 278 C; 332 G; 247 T; 0 other;
     tgattataag gggggaaaaa gatgtgccct ctgtctttta gggttacggc cggtggagag        60
     cagctggaca gcccgagcat atgcagcagc agcagccact ggaacccaga gagagcatga       120
     gctccaagcc aaagtcctta gagattatcg gagcgccttt ctcaaaagga cagcctcgag       180
     gaggggtaga gaaaggccct gcagcactga ggaaagctgg tcttctggaa aaacttaaag       240
     aaacagagta tgacgtgaga gaccacgggg acctggcctt tgttgatgtc cctaatgaca       300
     gctcctttca aattgtgaag aacccacggt ctgtggggaa agccaatgaa gagctggctg       360
     gtgtggtggc agaggtccag aagaatggaa gagtcagtgt ggtgctgggt ggagaccaca       420
     gtctggcagt tggaagcatc tctggccacg ccagggtcca ccctgaccta tgtgtcattt       480
     gggtggatgc tcacactgac atcaacactc ccctgacaac cagctctggg aatctgcatg       540
     ggcaacctgt gtcctttctc ctgaaggaac tgaaaggaaa gttcccagat gtaccaggat       600
     tctcctgggt gactccctgc atatctgcca aagacatcgt gtacattggc ttgcgagacg       660
     tagaccctgg ggaacactat ataataaaaa ctctgggaat taagtatttc tccatgactg       720
     aagtagacaa gctggggatt ggcaaggtga tggaagagac cttcagctac ctgctgggaa       780
     ggaagaaaag gccgattcac ctgagctttg atgtcgacgg gctggaccca gcattcaccc       840
     cggcgaccgg caccccggtt ctgggaggcc tatcttacag agaaggtctc tacatcacag       900
     aagaaattta caagacaggg ctcctttcag gactagatat catggaagtg aacccaactc       960
     ttgggaagac agcagaggag gtgaagagta ctgtgaacac ggcagtggct ttaaccttgg      1020
     cttgtttcgg aactcaacgg gagggtaacc ataagccagg gactgactac cttaaaccac      1080
     ctaagtgact gtgaatgcgc cacatgaaaa ccatctgggg catcacagca aagcagacag      1140
     agctaagcaa acgccttctc ctcccaaggg cttgttcttt tagaaaaaaa aaaaaaaa        1198
//