spacer

EBI Dbfetch

ID   BC049145; SV 1; linear; mRNA; STD; MUS; 3511 BP.
XX
AC   BC049145;
XX
DT   25-MAR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus cyclic nucleotide gated channel alpha 3, mRNA (cDNA clone
DE   MGC:56803 IMAGE:5357087), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3511
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3511
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (21-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a534d27876b5949da349a487c75be7ed.
DR   Ensembl-Gn; ENSMUSG00000026114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027288; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194195; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 105 Row: b Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 33859523.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3511
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:56803 IMAGE:5357087"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3511
FT                   /gene="Cnga3"
FT                   /note="synonym: CNG3"
FT   CDS             314..2209
FT                   /codon_start=1
FT                   /gene="Cnga3"
FT                   /product="cyclic nucleotide gated channel alpha 3"
FT                   /db_xref="GOA:Q9JJZ8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="MGI:MGI:1341818"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJZ8"
FT                   /protein_id="AAH49145.1"
FT                   /translation="MAKVNTQCSQPSPTQLSIKNADRDLDHVENGLGRVSRLIISIRAW
FT                   ASRHLHDEDQTPDSFLDRFHGSELKEVSTRESNAQPNPGEQKPPDGGEGRKEEPIVVDP
FT                   SSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRA
FT                   RTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKLGVNYPELRFNRLLKF
FT                   SRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNT
FT                   SKPEYARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNV
FT                   GSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLK
FT                   NLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGR
FT                   EMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDL
FT                   FCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLIDEDLVAARVDTRDVEEKVEYLES
FT                   SLDILQTRFARLLAEYSASQMKLKQRLTRLESQMNRRCCGFSPDRENSEDASKTD"
FT   misc_difference 3498..3511
FT                   /gene="Cnga3"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3511 BP; 854 A; 867 C; 916 G; 874 T; 0 other;
     ctcaggctgc caatctactg gctactctgg gctgggactg tggagctagg aagtgggaaa        60
     agctgatcca ggttttgttt tgttttgttt tgttttgttt tgttttgttt tgttttgttt       120
     ttctcatcat ctccctctct gatgctgttg ggactttgat cttcagaagc aagcgtcttc       180
     ctaggcacgg cttgcctcct tcaagaagga gacttaagca gagcggtgtg gagtctgcag       240
     ccttcgataa gcaggcattg gtgaaacagc ctcacagcag gccaccccgg ggctgaatgt       300
     gacctgtgca gagatggcaa aggtgaacac ccagtgttca cagccctccc cgacccaact       360
     ttcaataaag aatgcggaca gagatctcga ccacgtagag aacggcctgg gcagggtgtc       420
     acgcctcatc atctcgattc gtgcgtgggc ctccaggcac ttacacgatg aagaccagac       480
     acctgactcc tttttggatc gatttcatgg atctgagctt aaggaagtct ccacccggga       540
     aagcaatgcc cagcccaacc caggagaaca gaagccacca gacggagggg aaggcaggaa       600
     ggaggagccc attgtggtgg acccctccag caacatctac taccgctggc tgactgccat       660
     cgcgctccca gtcttctata actggtgtct acttgtatgc agggcctgtt ttgatgagct       720
     acaatcagag cacctgacgc tgtggctggt cttggactac tctgcagatg tcctttatgt       780
     tttagacatg ctggttcgag cccggacagg tttccttgag caaggcctaa tggtcagaga       840
     taccaagagg ctgtggaaac attacacaaa gaccttgcac ttcaagctgg acatcctgtc       900
     tctcatcccc acagacctgg cttatttaaa gttgggcgtg aactacccag aactgaggtt       960
     caaccgcctc ctgaagttct ctcggctctt tgaattcttt gaccgcacag agacaaggac      1020
     caactacccc aacgtgttca ggatagggaa cttggtcctt tacacactca tcatcatcca      1080
     ctggaatgcc tgcatctact ttgccatttc caagttcatt ggttttggga cagactcctg      1140
     ggtctatcca aacacctcca agccggagta tgcacgactc tcccggaagt acatttacag      1200
     tctctactgg tccaccctga ccctgaccac cattggtgag accccacccc ccgtgaaaga      1260
     tgaagagtat ctctttgtgg tcatcgactt cctggtgggt atcctgatct ttgccaccat      1320
     agtgggcaac gtaggctcca tgatttccaa catgaacgct ccccgggtag agttccaggc      1380
     taagatcgac tccgtcaagc agtacatgca gttccggaag gtaaccaagg acttggagac      1440
     tcgggttatc cggtggtttg actatctgtg ggccaacagg aagacggtgg atgaaaagga      1500
     agtgctcaaa aacctcccgg acaagctgaa ggctgagatc gccatcaacg tgcacctgga      1560
     cacgctgaag aaggtccgaa tcttccagga ctgcgaggcg gggctgctgg tggagctggt      1620
     gctgaagctc cgccccactg tgttcagccc cggggactac atatgcaaaa agggggacat      1680
     tggaagagag atgtacatca tcaaggaggg caagctggct gtggtggctg atgacggggt      1740
     cacccagttt gtggtcctca gtgacggcag ttactttggg gagattagca tcttaaacat      1800
     taaggggagc aagtctggga accgcaggac ggccaacatc aggagtatcg gctactcaga      1860
     cctgttctgc ctctccaagg atgacctaat ggaagccctc accgagtacc cagacgctaa      1920
     gagggctctg gaggaaaagg gccgtcagat tctgatgaag gacaacctaa ttgatgagga      1980
     cctagtcgcg gccagggtag ataccaggga cgttgaggag aaggtggagt acctggagtc      2040
     gtccctggac atcctgcaga cgaggtttgc ccgactcctg gctgagtaca gtgcctccca      2100
     gatgaagctg aaacagcggc tcactcggct ggagagccag atgaacagga ggtgttgtgg      2160
     cttctcacct gacagggaga attccgagga tgcttcaaag actgactgaa aatgcaggtg      2220
     gctctgcctc ctgctccccc cccccccccc cggggccagc tctctgggcg acactatata      2280
     gcctcggggt aaagggtttg gctgtggttt cgcctcagtg ctactcatcc tttgggagtg      2340
     gtgtgacagc aaggaagagc cttagtttcc tctcctatga aatgggactc atggctgtcg      2400
     gccccagaag ttccagacta tcatgaggtg gcgaaggttg tggctttgga aagcgtgaag      2460
     agttcccaac ccagtgtata agcatatgtg cacatgattc taatgttgtt agttatgttg      2520
     gcatatgggt atgttcagtt gtcggcggag gtcaggagag ggcgttgcat cccctgggct      2580
     ggagttacct gctgttgtaa gctacccagc atgggtgctg ggatcctgtc ttcattaggg      2640
     ttactattgc tgtgatgaaa tatcataacc aatgcaagtt aggaagaaaa ggtttttttt      2700
     tcggcttaca ctccacatca tagtccatca ttgaaggaag tcagggcagg aactcaaact      2760
     gggcaggaag ctggaggcag gagctgatgc agaggccata aaggggagct gcttactggt      2820
     ttgctcttct tagcttgcta agcctgcttt cttatagaac ccagaaccac cagcccggga      2880
     gtagtcctac ttgcaatggg ctaggccctc cttcatctat cattagttaa ggaaatgctc      2940
     cacggacttg cctacagctg gatcttaggg aggcattttc tcagtcatcc tctcagatga      3000
     ctctaacttg tgtcaagttg acataaaaat ccgaccagca caaatccaaa cgtgtagtcc      3060
     ttcccatatt tattgaggtg aaggtcctgc tctgttaccc agtccagcct tcaactccca      3120
     tgcccaagtg ttgtcccctc gccagccttc caagtagctg ggaccacagg cacactccac      3180
     tgtttccaac ccagataagt tttgttttgt tttgttttgt tttgttttgt tttgttttaa      3240
     tgaaatccat gggaatgttt aagcccctta tcctagctat gttataaatg gatgtcttac      3300
     ggggctggtg agataactca gtggttaaga gcactagctg ctcttccaga ggtcatgagt      3360
     tcaattccca gcaaccacaa ggtggctcac aaccatctat agggggatct gatgccctct      3420
     tcgggcaggt ggatatatgt gcaaaagagc actcatacat taaataataa atacaattaa      3480
     agatatatat aaatggaaaa aaaaaaaaaa a                                     3511
//


spacer
spacer