Dbfetch

ID   BC049114; SV 1; linear; mRNA; STD; MUS; 2876 BP.
XX
AC   BC049114;
XX
DT   22-MAR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus valosin containing protein, mRNA (cDNA clone MGC:61308
DE   IMAGE:6810751), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2876
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2876
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 28846275ee9fd098e8da36ead7af80af.
DR   Ensembl-Gn; ENSMUSG00000028452; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028196; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028152; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028104; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028172; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027894; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028613; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027334; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_FVBNJ_G0027976; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028108; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028649; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027060; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027414; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000030164; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065244; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0065290; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0065186; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065220; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064895; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065689; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065206; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_FVBNJ_T0064901; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0065077; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065865; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064742; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064104; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 30023841.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2876
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FW0"
FT                   /clone="MGC:61308 IMAGE:6810751"
FT                   /tissue_type="Brain, mouse, 13.5, 14.5, 16.5, 17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2876
FT                   /gene="Vcp"
FT                   /note="synonyms: p97, CDC48, 3110001E05"
FT   CDS             278..2698
FT                   /codon_start=1
FT                   /gene="Vcp"
FT                   /product="valosin containing protein"
FT                   /db_xref="GOA:Q01853"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="MGI:MGI:99919"
FT                   /db_xref="PDB:1E32"
FT                   /db_xref="PDB:1R7R"
FT                   /db_xref="PDB:1S3S"
FT                   /db_xref="PDB:2PJH"
FT                   /db_xref="PDB:3CF0"
FT                   /db_xref="PDB:3CF1"
FT                   /db_xref="PDB:3CF2"
FT                   /db_xref="PDB:3CF3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01853"
FT                   /protein_id="AAH49114.1"
FT                   /translation="MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPK
FT                   MDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQP
FT                   CPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEF
FT                   KVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVEL
FT                   PLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGE
FT                   SESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH
FT                   VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQV
FT                   ANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ
FT                   SNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFY
FT                   GPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFF
FT                   DELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILR
FT                   PGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA
FT                   CKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIR
FT                   KYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG"
FT   misc_difference 2871..2876
FT                   /gene="Vcp"
FT                   /note="polyA tail: 6 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2876 BP; 721 A; 666 C; 796 G; 693 T; 0 other;
     tgattcggct tttctcggtt cagtctccgt gaagcgtttg cagccgtcgt ttgattagtc        60
     gctgcccccc tcgcggatta ggagctagcg tctcccgccc gcccgcctgc cgccccggtg       120
     cccctgggag gaagcgagag ggaggctgcc agagggtttg tcactgctgt tgctcctccg       180
     cctcagcgag tccagccccg gcctagtcgg tcgcctgcct ttctcatagc cgttaccctc       240
     aggccgccac agccgccgac cgggagaggc gcgcgccatg gcctctggag ccgattcaaa       300
     aggtgatgat ttatcaacag ccattctcaa acagaagaac cgacccaatc ggttaattgt       360
     tgatgaagcc atcaatgaag ataacagcgt ggtgtccttg tcccagccca agatggatga       420
     actgcagttg ttccgaggtg acacggtgtt gctaaaagga aagaaaagac gggaagctgt       480
     atgcattgtt ctttctgatg acacgtgttc tgatgagaag attcgaatga atagagttgt       540
     tcggaataac ctccgagttc gcctaggaga tgtcatcagc atccagccat gccctgatgt       600
     aaagtatggc aaacgtatcc acgttctacc catcgatgac acagtggaag gcatcactgg       660
     caatctcttt gaggtatacc ttaagccgta cttcctggaa gcttatcggc ccatccgtaa       720
     aggagatatt tttcttgtcc ggggtgggat gcgtgctgtg gagttcaaag ttgtagagac       780
     agatcccagc ccttactgta ttgttgctcc agacacagtg atccactgtg agggggagcc       840
     aatcaagcga gaggatgagg aggaatcctt gaatgaagta ggctatgatg acatcggtgg       900
     ttgcaggaag cagctagctc agataaagga gatggtggag ctgccactga gacatcctgc       960
     gctctttaag gcgattggtg taaagcctcc tcggggaatc ttgttgtatg ggcctcctgg      1020
     gacagggaag accctgattg ctcgagctgt ggcaaatgaa actggagcct tcttctttct      1080
     gatcaatggt cctgaaatca tgagcaaatt ggctggtgag tctgagagca accttcgtaa      1140
     agcctttgag gaagctgaaa agaatgctcc tgctatcatc ttcatcgatg agcttgatgc      1200
     cattgcaccc aaaagagaga aaactcatgg ggaagtggag cgtcgcatcg tgtctcagtt      1260
     gttgaccctc atggatggcc taaagcagag agcacatgtg atagttatgg cagcaaccaa      1320
     tagacccaac agcattgacc cagccctacg gcgatttggt cgctttgaca gagaggtaga      1380
     tattggaata cctgatgcta caggacgttt ggagattctt cagatccata ccaagaacat      1440
     gaaactggca gatgatgtgg acttggaaca ggtagccaat gagactcatg gtcatgttgg      1500
     tgctgatttg gcagccctat gttcagaggc tgctctgcag gccatccgga aaaaaatgga      1560
     cctcattgac ctagaagatg agaccattga tgctgaggtc atgaattccc tggcagttac      1620
     tatggatgac ttccggtggg ctttgagtca aagcaaccca tcagcacttc gggaaactgt      1680
     ggtagaggtg ccacaagtaa cctgggaaga tattggaggc ctggaggatg tcaaacgtga      1740
     gcttcaggag ttggttcagt atcctgtgga acatccagac aaattcctca aatttggcat      1800
     gactccctcc aaaggcgttc ttttctatgg acctcctggc tgtgggaaaa ccttactggc      1860
     taaagccatt gctaatgaat gccaggccaa cttcatctcc atcaagggtc ctgagctgct      1920
     taccatgtgg tttggggaat ctgaggccaa tgtccgggaa atttttgaca aggcacggca      1980
     agctgccccc tgtgtactct tctttgatga gttagattca attgccaagg ctcgaggtgg      2040
     taatattgga gatggtggtg gagctgctga ccgagtcatc aatcagatcc tgacagaaat      2100
     ggatggcatg tctacaaaaa agaatgtgtt tatcattgga gctaccaaca ggcctgacat      2160
     cattgatcct gctatcctaa gacctggccg tctagatcag ctcatttata tcccacttcc      2220
     tgatgagaag tcccgtgttg ccatcctaaa agccaatctg cgaaagtccc cagttgccaa      2280
     ggatgtggat ttggagttcc tggctaagat gactaatggc ttttctggag ctgatttgac      2340
     agaaatttgc caacgggctt gtaaactggc cattcgtgaa tctattgaga gtgagattag      2400
     gcgagaacga gagaggcaga caaatccatc ggctatggag gtagaagagg acgatccagt      2460
     gcctgagatc cgcagagatc actttgagga agccatgcgt tttgcccgac gttctgtcag      2520
     cgataatgac attcggaagt atgaaatgtt cgcccagaca ctgcagcaga gtcgaggttt      2580
     tggcagcttc agattccctt cagggaacca gggtggagct ggtcccagcc agggcagtgg      2640
     aggtggcaca ggtggcagtg tgtacacaga agacaatgac gatgacctgt atggctaagt      2700
     gatgtgccag catgcagcga gctggcctgg ctggaccttg ttccctgggg gagggggcgc      2760
     ttgcccaaga gggaccaggg gtgtgcccat ggcctgttcc attcctcagt ctgaacagtt      2820
     cagccccagt cagactctgg acaggggttt cctgttgcaa aaaaaaaaaa aaaaaa          2876
//