spacer

EBI Dbfetch

ID   BC049104; SV 1; linear; mRNA; STD; MUS; 4130 BP.
XX
AC   BC049104;
XX
DT   22-MAR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus oxoglutarate dehydrogenase (lipoamide), mRNA (cDNA clone
DE   MGC:61404 IMAGE:6417392), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4130
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4130
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 6eb00e4a07070e7752ee7a920af489be.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101554; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 35) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4130
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FI0"
FT                   /clone="MGC:61404 IMAGE:6417392"
FT                   /tissue_type="Brain, enriched mouse brain 12.5dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4130
FT                   /gene="Ogdh"
FT                   /note="synonym: mKIAA4192"
FT   CDS             137..3196
FT                   /codon_start=1
FT                   /gene="Ogdh"
FT                   /product="Ogdh protein"
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /protein_id="AAH49104.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVA
FT                   AEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSL
FT                   ATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQVRGHHIAKLDPLGISCVNFDDAPVT
FT                   VSSNVGFYGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEFMFIN
FT                   DLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEV
FT                   LIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGS
FT                   GDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKV
FT                   MSILLHGDAAFAVQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPT
FT                   DVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMF
FT                   TQPLMYKQIRKQKPVLQKYAELLVSQGFVNQPEYEEEISKYDKICEEAFTRSKDEKILH
FT                   IKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGLSRIL
FT                   KTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKR
FT                   TCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNMAQCI
FT                   IDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLQEEN
FT                   FDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEM
FT                   LPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQLS
FT                   PFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGRDPAAA
FT                   PATGNKKTHLTELQRFLDTAFDLDAFKKFS"
FT   misc_difference 1371
FT                   /gene="Ogdh"
FT                   /note="'T' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'V' in cDNA, 'G' in the mouse genome."
FT   misc_difference 1769
FT                   /gene="Ogdh"
FT                   /note="'T' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'F' in cDNA, 'V' in the mouse genome."
FT   misc_difference 4096..4130
FT                   /gene="Ogdh"
FT                   /note="polyA tail: 35 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4130 BP; 1019 A; 1090 C; 1048 G; 973 T; 0 other;
     gagggtggag ttttagatcc ttgacgtcaa aaggtcactc aaggaacacc tctacaggcc        60
     caagtggggt cagtggggtc aacctgtatt cgatggaggt ctctacgtcc gtacttgtgg       120
     aaggcttcag gacaaaatgt ttcatttaag gacttgtgct gctaagttaa ggccattgac       180
     agcctcccag actgttaaga cattttcaca aaacaaacca gcagcaatta ggacgtttca       240
     acagattcgg tgctattctg cacctgtagc tgctgaacca tttcttagtg ggactagttc       300
     gaactatgtg gaggaaatgt actgtgcctg gttggagaat cccaaaagtg tacataagtc       360
     atgggacatt tttttccgaa acaccaatgc tggagcccca ccgggcactg cctaccagag       420
     ccccctttcc ctgagtcgaa gctccctggc taccatggcc catgcacagt ccctggtgga       480
     agcacaacct aacgtcgaca aactcgtgga ggaccacttg gcggtgcagt ctctcatcag       540
     ggcatatcag gtcaggggtc accacattgc aaaacttgat cctctcggaa ttagttgtgt       600
     aaattttgat gatgctccgg taactgtttc ttcaaacgtg gggttctatg gcctacacga       660
     gtctgacctt gacaaggtct tccacttacc caccaccact ttcatcgggg gacaggagcc       720
     agcacttcct cttcgggaga tcatccgtcg gctggagatg gcctactgcc agcacattgg       780
     tgtggagttc atgttcatta atgatttgga acaatgccag tggatccgac agaagtttga       840
     gacccctgga atcatgcagt tcaccaatga ggagaagcgg accttgctgg ccaggcttgt       900
     acgatccacc aggtttgagg agttcctaca gcgaaagtgg tcctcggaga agcgttttgg       960
     tctggaaggc tgtgaggtgc tgatccctgc cctcaagaca atcattgata tgtcaagtgc      1020
     aaatggagtg gactatgtga tcatggggat gccacacaga ggacggctga acgtgcttgc      1080
     aaatgtcatc aggaaggagc tggagcaaat attctgtcag tttgactcaa agctggaggc      1140
     agctgatgag ggttctgggg acatgaagta ccacctgggc atgtatcacc gcaggatcaa      1200
     ccgtgtgacc gacagaaaca tcactttgtc cttggtggct aacccttccc atctagaggc      1260
     tgctgaccct gtcgtgatgg gaaagaccaa agctgaacag ttctactgtg gagacactga      1320
     agggaaaaag gtgatgtcta tcctgctgca tggggatgct gcttttgctg tccagggcat      1380
     cgtatatgag accttccatc tcagcgactt gccgtcctac acaacccatg gcactgttca      1440
     tgtggttgtc aacaaccaga ttggcttcac cacagaccct cggatggccc gctcctctcc      1500
     ctaccccact gatgtggccc gagtggtgaa tgcccccatt ttccatgtca actcagatga      1560
     ccctgaagct gtcatgtatg tatgcaaggt ggcagctgag tggagaaaca ccttccacaa      1620
     ggatgttgta gttgatctgg tgtgttatcg acgaaatggc cacaatgaga tggacgaacc      1680
     tatgtttaca cagccactca tgtacaagca gatccgcaag cagaagcctg tactgcagaa      1740
     gtatgcagaa ttgctagtct cccagggttt cgtcaatcag cctgagtacg aggaggaaat      1800
     ctccaagtat gataagatct gtgaggaagc atttaccaga tccaaagatg agaagatctt      1860
     gcacatcaag cactggctgg attccccctg gcctggcttt ttcaccctgg atggacagcc      1920
     caggagcatg acctgcccct ccactggcct ggaggaggat gtcttgttcc acattggaaa      1980
     ggtggccagc tctgtacctg tggagaactt tactatccat ggagggctga gccggatctt      2040
     gaagacccgc agagagcttg tgacgaaccg gactgtggac tgggccctgg cagagtacat      2100
     ggcatttggc tcactgctga aggaaggcat ccatgtgcgg ctgagtggcc aggatgtgga      2160
     gcggggcacc ttcagccatc gccaccatgt gctccatgat cagaatgttg acaaaagaac      2220
     ctgcatcccc atgaaccacc tttggccaaa tcaggcccct tacactgtat gcaacagctc      2280
     gctgtctgag tacggtgtcc tgggctttga gctgggcttt gccatggcta gccctaatgc      2340
     tctggttctc tgggaggccc agtttggtga cttcaacaac atggcacagt gcatcattga      2400
     ccagttcatc tgcccaggac aggcaaagtg ggtgcggcag aatggcattg tgctcctgct      2460
     gcctcatggc atggaaggca tgggtcccga gcattcctct gcccgcccag agcggtttct      2520
     gcagatgtgc aatgatgacc cagatgtcct gcctgacctg caggaagaaa actttgacat      2580
     caatcagctc tatgactgca actggattgt tgtcaactgt tccacccctg gcaacttctt      2640
     ccatgtgctg cgacgacaga tcttgctgcc cttccggaag ccgttaatcg tcttcactcc      2700
     caaatccctc ctgcgccacc ctgaggcaag aactagcttt gacgagatgc tgccaggaac      2760
     gcacttccag cgtgtgatcc cagaaaatgg acctgcagct caggacccac acaaagtcaa      2820
     gagacttctc ttctgcactg ggaaggtgta ctatgacctc acccgagagc gcaaagccag      2880
     gaacatggag gaggaggtgg ctattacaag gattgagcag ctatcaccat tcccctttga      2940
     cctcctgctg aaagaggcac agaagtatcc caatgctgag ctggcctggt gccaggaaga      3000
     gcacaagaac caaggctact atgactatgt caagccaaga cttcgtacca ccattgaccg      3060
     tgctaagcct gtctggtatg ctggccgaga cccggcagct gctccagcca ctggcaacaa      3120
     gaaaacacac ctgacagagc tgcagcgctt tctggacaca gcctttgacc tggacgcatt      3180
     caagaaattc tcttagatgc tcctggagtt gatgaggcca tggcccccat gtccatgacg      3240
     ctctttgctt ctcaactaaa gaatagtgcc tcagcactgt ccacacgtcc cttcgctgtg      3300
     ccacaccacc cctgttctca taggaattaa gttgtccact gcagtgctca gctgctcccc      3360
     ggtcacatgc tgcccagcct gtgccgactt ctctcaggct gcacaccgtt catggagacc      3420
     ggaaggagca gaataaggaa agggcccctc tcaggacatc ctagagaagg aaggcagctc      3480
     tggccccacc catgccccca gtgcaatcct ccagggtagg aacagaaccc tatgtggctt      3540
     cccagggtac tagcactcag ccctcgtcac ccatcaagtc gcagattcaa ggccaggagt      3600
     agtttcatct tgctagggcc aagctgagag ctcatggagg aactatagct gccaggattt      3660
     gggagtcatc aggatgttgt gtgaatagag attgtcatgg ggtatttaga ggactttagc      3720
     agtgatgtta gtctagccct gctacccttc ttgggtttgg gctgtatgtg ggaaacttac      3780
     cccagctacc acgcctggag agcttggctc tgagtacggc ccagaagctc cattggctcc      3840
     caacgccagg cactgctgcc tcttggtcct gctgcctctg ctctcctgac ccctccccag      3900
     tcacttcatt ttctctgttg ttcccttgaa cacacagaag ctgttgacga attctttttt      3960
     ttgctgtgcc aaggcaggtc aaaagcagat cagtggataa gagcaagttg tcccaaggag      4020
     ccagctgtcc ttcctccctc ttttgacctc cactgggaca cacctgattt atttattttg      4080
     gttaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                 4130
//


spacer
spacer