Dbfetch

ID   BC048782; SV 1; linear; mRNA; STD; MUS; 3546 BP.
XX
AC   BC048782;
XX
DT   19-MAR-2003 (Rel. 75, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus potassium voltage-gated channel, shaker-related, subfamily,
DE   member 6, mRNA (cDNA clone MGC:54601 IMAGE:6466414), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3546
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3546
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (14-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a98239ae84adcf1d6d080356fc4e0c8b.
DR   Ensembl-Gn; ENSMUSG00000038077; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031304; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031275; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031203; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031282; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031006; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031739; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030387; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030967; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031123; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031072; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031203; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031111; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031774; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030102; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030472; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000040751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112242; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185333; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080265; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080344; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080265; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080281; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079904; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080748; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080477; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079855; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080014; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079888; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080051; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079906; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081013; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079908; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0078997; mus_musculus_wsbeij.
DR   RFAM; RF00485; K_chan_RES.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: j Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328479.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3546
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:54601 IMAGE:6466414"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3546
FT                   /gene="Kcna6"
FT                   /note="synonyms: Kv1.6, MK1.6"
FT   misc_difference 1..3
FT                   /gene="Kcna6"
FT                   /note="3 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 5
FT                   /gene="Kcna6"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 10
FT                   /gene="Kcna6"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   CDS             233..1822
FT                   /codon_start=1
FT                   /gene="Kcna6"
FT                   /product="potassium voltage-gated channel, shaker-related,
FT                   subfamily, member 6"
FT                   /db_xref="GOA:Q61923"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003972"
FT                   /db_xref="InterPro:IPR004053"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:96663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61923"
FT                   /protein_id="AAH48782.1"
FT                   /translation="MRSEKSLTLAAPGEVRGPEGEQQDAGEFQEAEGGGGCCSSERLVI
FT                   NISGLRFETQLRTLSLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGG
FT                   RLRRPVNVPLDIFMEEIRFYQLGEEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLL
FT                   FEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRADGRGGSNEGSGTRLSPASRSH
FT                   EEEDEDEDSYAFPGSIPSGGLGTGGTSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVR
FT                   FSACPSKAAFFRNIMNIIDLVAIFPYFITLGTELVQRHEQQSVSGGSGQNGQQAMSLAI
FT                   LRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEA
FT                   DDVDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIV
FT                   SNFNYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRPSYLPTPH
FT                   RAYAEKRMLTEV"
FT   misc_difference 3470..3546
FT                   /gene="Kcna6"
FT                   /note="polyA tail: 77 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3546 BP; 820 A; 934 C; 914 G; 878 T; 0 other;
     catcgtctcg gaaatcctga gcacggaggc gcggctattg agagccagag ccacttccca        60
     gacctagcct ggcagaggga ccagctgcag ggctcaccga cctaaccgcc aggtcagagc       120
     acgggcccca ccctaaagga gggcacagcc gaagctgtga agcgggtgcc gctctctgga       180
     gctcgtgtcg tgggcgccgt cctagtggcg gggagcgcac cgccgaggtg acatgagatc       240
     ggagaaatcc ctgacgctgg cggcgccggg ggaggtccgt gggccggagg gggagcaaca       300
     ggatgcgggt gagttccagg aggccgaggg cggcggcggc tgctgtagta gtgagaggtt       360
     ggtgatcaac atctccgggc tgcgcttcga gacgcagctg cgcaccctgt cgctgttccc       420
     tgacacgctg ctaggagacc ctggccgcag agtccgtttc tttgacccct tgaggaacga       480
     gtacttcttt gaccgcaacc gacccagctt cgacgctatc ctttattact atcaatctgg       540
     aggtcgcctg cgcaggcctg ttaatgtgcc cctggacatt tttatggaag agatccgctt       600
     ctatcagttg ggagaggaag ccctggcggc cttccgggag gatgagggtt gcctgcccga       660
     aggtggcgag gatgagaaac cactcccctc ccagcctttc cagcgacagg tctggcttct       720
     ctttgagtac ccggagagtt ccgggcccgc ccgaggcatc gccatcgtct cagtattggt       780
     catcctcatc tccatcgtca tcttttgcct ggagaccttg cctcaattcc gtgcagatgg       840
     gcgcggtgga agcaacgagg gtagtgggac ccgcttgtct ccggcctcca ggagccacga       900
     ggaagaagat gaggatgaag attcctatgc atttcctggt agcattccct ctggggggtt       960
     ggggactgga ggaacatctt cacttagtac tctcgggggt tctttcttca cagacccctt      1020
     cttcttggtg gaaactctgt gtatcgtctg gttcacgttt gagctcctgg tgcgcttctc      1080
     tgcctgtccc agcaaggcgg ccttctttcg caatatcatg aacatcattg acttggtggc      1140
     cattttcccc tactttatca ccttgggcac cgagctagtg caacgtcacg agcagcagtc      1200
     tgtgagtggt ggcagtggtc agaatgggca gcaggccatg tccctagcca tcctcagggt      1260
     gatccgcctg gtccgggtgt tccgaatctt caagctctcc cgccattcca aggggctgca      1320
     gatcctgggt aagaccttac aggcgtccat gcgggagctc gggctgctca tcttcttcct      1380
     cttcatcgga gtcatcctct tttccagcgc tgtctacttc gcagaggctg atgatgttga      1440
     ctcgctcttc cctagcatcc cagatgcctt ctggtgggct gtggttacaa tgaccacggt      1500
     aggttatggg gacatgtacc ccatgacggt agggggcaag attgtgggct cactgtgcgc      1560
     cattgctggg gtcctcacca ttgcattacc ggtaccggtc attgtctcca atttcaacta      1620
     cttctaccac cgagagacgg agcaggagga gcaaggccag tatacccacg tcacttgtgg      1680
     gcagcccact ccggacttga aggcaacgga caatgggctt ggcaaacctg actttgccga      1740
     ggcttcacgg gaacgccggc ccagctacct tccgactcca catcgagctt atgcggagaa      1800
     aaggatgctc accgaggttt gatggatgcg ggcaggcctg caggaaaaca ggagctctga      1860
     gcaagtcatc tctcaggctt ccttctcatg ctcactactt ccgccttagc tccagaggac      1920
     ctcgaacccc cctcccccct aacacagtac atggcatctt ggaccaaata tctggactgt      1980
     agactgttgc tcgatcctcg cagcattcga ggtttctcca tcttagtgac attttggaaa      2040
     tttcaacggt gccacccaat catgcccatc agtcacgtgg atgagatgca cgtttctgac      2100
     tgatcttccc tcaagactga gttttcatgc ctgggtcttg taatatctct aggaatggtg      2160
     acaccagtag aataggaagc agctacactc aggtcccttc tttagtgtcc tttgctttgg      2220
     gtcatgcacc ttccttactt agcttctggt cacttggtca ctggcagaat ctggagaatg      2280
     gaaaagattt cagcttggca ttttagtgcc caagccatct tctgactggt agagctatta      2340
     gctgcacggc tttgaaagat atggctaaat ttggatggaa ttagagaaaa tactacccaa      2400
     ctggattatt tgaaggacat gaaggtcagt tttagaccaa tgggggccgg tggatttctc      2460
     tagttgtgat ctgtcacagg agatgctggc aggggtctac attagtcctc accactctga      2520
     ttccatgact tccttgcgct tccaggaaga aacttggcac tttctcagag ccaagttctt      2580
     tttatgtgca agcgccttcg tgtgcagagg aactggaaaa tagaactaca gagacaggag      2640
     aaaaggctga ccagagccaa aggactggct ggaccacata tctgaagcaa ggtgccactt      2700
     aagcagagac tgtcacttag aacaggcaga gggactctgc tgcagacagc agccaattcc      2760
     tccagattag ctcagacctc tttaagatat cctccaccct ttttcctggg aatctgacct      2820
     aggattgcaa atggatttgt ttttataaag caacctcagc tgtaacctac agacaggtga      2880
     gttcacacat tgaatgccag catagctttc ctcttatgcc acaggcaaca gcctttggtt      2940
     gggagccagg gaagggcacg gtcattttgt tggcagcctc tctcttagag gattttgctg      3000
     agtcaagcaa acgtttgtct gctcagctct tcctttggag ctgcattggg cctgctaagg      3060
     taactcggtc gttcctactt ggaccaagcc atcttctccc attgtgaaat cactgccacc      3120
     ctcccagctg cccactgccc cctcccccag taacattgcc attcagtttt gcctttgata      3180
     aactgtgata cactcttctc agttctcatg ggtacagctc tgaaactcaa aggactgtta      3240
     acatgttttt aattttctat tgatgcttta agactcttcg aagggaatgg cttttcaaaa      3300
     gatttttttt ttccctgaag aacaacttag gaaggagtga ccttgatggt tggcttgaga      3360
     ggccactgtg gctccactct gagttttgcc acagctttac agggtaactc tggtgtcatg      3420
     gtccctcttt gtgcctcagt tccccccacc cattaaatga gaacattaaa aaaaaaaaaa      3480
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3540
     aaaaaa                                                                 3546
//