spacer

EBI Dbfetch

ID   BC048231; SV 1; linear; mRNA; STD; MUS; 2018 BP.
XX
AC   BC048231;
XX
DT   01-APR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus vesicle-associated membrane protein, associated protein B and
DE   C, mRNA (cDNA clone MGC:54551 IMAGE:6313869), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2018
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2018
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 44ad38fa815b0e29cabe469308193b7a.
DR   Ensembl-Gn; ENSMUSG00000054455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067530; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: e Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328447.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2018
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:54551 IMAGE:6313869"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2018
FT                   /gene="Vapb"
FT                   /note="synonyms: Vamp33b, VAP33b"
FT   CDS             123..854
FT                   /codon_start=1
FT                   /gene="Vapb"
FT                   /product="vesicle-associated membrane protein, associated
FT                   protein B and C"
FT                   /db_xref="GOA:Q8BH80"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="MGI:MGI:1928744"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BH80"
FT                   /protein_id="AAH48231.1"
FT                   /translation="MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVK
FT                   TTAPRRYCVRPNSGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEA
FT                   VWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKIIPTSASKTEAPAAAKSLTSPLDD
FT                   TEVKKVMEECRRLQGEVQRLREESRQLKEEDGLRVRKAMPSNSPVAALAATGKEEGLSA
FT                   RLLALVVLFFIVGVIIGKIAL"
FT   misc_difference 1994..2018
FT                   /gene="Vapb"
FT                   /note="polyA tail: 25 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2018 BP; 513 A; 488 C; 574 G; 443 T; 0 other;
     tgcgtgggta cgtcgtgcgt gccgtgagct cgcccggcac cgcggcctcg ccctccgccc        60
     ctgcgccccg ccacccaggc cgccgccccc cgcccgcgcc gtcgcccccg acggggagga       120
     ccatggcgaa ggtggaacag gtcctgagcc tcgagccaca acacgagctc aagttccgag       180
     gtcccttcac tgatgttgtc accaccaacc taaagcttgg caacccaaca gaccgaaatg       240
     tgtgttttaa agtgaagacc acagcacctc gcaggtactg cgtgcggccc aacagtgggg       300
     tcattgatgc cggggcctct ctcaatgtgt ctgtgatgtt acagcctttc gattatgatc       360
     ccaatgagaa aagtaaacac aagtttatgg ttcagtctat gtttgctccg cctgacactt       420
     ctgatatgga ggcagtatgg aaggaggcaa aaccggaaga ccttatggat tcaaaactta       480
     gatgtgtgtt tgaattgcca gcagaaaatg ctaaaccaca tgatgtagaa ataaataaaa       540
     tcatacctac gagtgcatcc aagacagaag caccggcagc cgcaaagtcc ctgacatcgc       600
     ccctcgatga cacagaagta aagaaggtga tggaagagtg caggcggctg cagggggagg       660
     tgcagaggct tcgggaggag agcaggcagc tcaaggaaga agacggactt cgggtgagga       720
     aggcgatgcc gagcaacagc cccgtggcgg ctctggcggc cactgggaag gaggagggcc       780
     tgagcgcccg gctgctggcc ctggtggttc tgttctttat cgttggtgtc attataggga       840
     agattgcctt gtaggggccg catgcgaagg atggcaggtt ggattgatgg atctaccaca       900
     ccatgggatt caaatttatc ataaccatgc gtaaaaagaa attaatgtat gacggcatct       960
     cacaggtctt gcctttaaat acccctcccc atgcacacac aaatgcacac acaaatatag      1020
     cataatataa tgatctttta gaaagttaaa aatgtatagg gaatggatgg ggaaagaatg      1080
     gtctgttgcc gtaggacggg ccgtgattaa ccacagtggc atcttgtagc tgtcacgctc      1140
     aattcgggta ggcctgggca cgtgttgcta gatcactctc ttaaagcaag aagctcctcc      1200
     tcgcatgttg gggctggccc gtgggagcgg gagtcctgca aggtggggcg agctgtcttt      1260
     ttcttaccca cgtggcttcc ccaggcctgc tgttctgtcc aggcatcgtc tcctcaggcc      1320
     tacagagctg caggtgccaa agtgcattgc acagaggcca catctcgtgt acctgtgggt      1380
     cgtgtgggag agacatgagt ggaccagcgg gtccaacaca gggaaatcca agtctgtgct      1440
     ctgttctctt gaagggacca agctaaatta ccgctggttc aagtagtgaa ccgagttgtt      1500
     ctcggagatg gctgatgcac atgtaaccta tttcatctcg tgtgttcctg ctgccaccag      1560
     agcacaggca gtgagtgctg cagaccgcca gtgaggagct gctgctgtgg gctctggagg      1620
     tctgagggaa ggggagggtc tgagtcagga agtgttttgt tgtaggtcag taatagctgc      1680
     cctgaggagg aacgctcttt ttaatgacag tcagctctgg attacccagt cttctagatt      1740
     gccctaccat ccatccttct aaaacatagg ccagccttga cctgcccttc tcaggatgag      1800
     tgagtcaggc tgcagagggt gaagggcata gagggggtgg ggtggggtgg gggagccctc      1860
     agcaaatcca tctgctggtg atgaagagtc ctgactgtga attaatttca tgccataaaa      1920
     gaccgatcca gttctgctca actatgtagc atcttaaagg aagagattaa aataaagccc      1980
     caaattaaga gtcaaaaaaa aaaaaaaaaa aaaaaaaa                              2018
//


spacer
spacer