Dbfetch

ID   BC048084; SV 1; linear; mRNA; STD; MUS; 1842 BP.
XX
AC   BC048084;
XX
DT   06-MAR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus antimicrobial peptide RYA3, mRNA (cDNA clone MGC:56907
DE   IMAGE:6312261), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1842
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1842
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-MAR-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c9fb9efc930c8ac01037547eceda01d7.
DR   Ensembl-Gn; ENSMUSG00000068008; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026702; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026668; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026639; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026678; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026420; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027127; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025881; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026399; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026534; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026500; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026639; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026522; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027182; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025615; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025951; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000088950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109760; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058435; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0058467; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0058406; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058403; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058096; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058875; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058364; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0058065; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0058168; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0058149; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0058298; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058120; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059049; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057935; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057378; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 105 Row: f Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 35902743.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1842
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:56907 IMAGE:6312261"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1842
FT                   /gene="Rya3"
FT   CDS             141..1562
FT                   /codon_start=1
FT                   /gene="Rya3"
FT                   /product="antimicrobial peptide RYA3"
FT                   /db_xref="GOA:Q80ZU7"
FT                   /db_xref="InterPro:IPR001124"
FT                   /db_xref="InterPro:IPR017942"
FT                   /db_xref="InterPro:IPR017943"
FT                   /db_xref="InterPro:IPR032942"
FT                   /db_xref="InterPro:IPR032951"
FT                   /db_xref="MGI:MGI:2675077"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80ZU7"
FT                   /protein_id="AAH48084.2"
FT                   /translation="MMLGVYTLLLLWGLATPCLGLLETVGTLARIDKDELGKAIQNSLV
FT                   GGPILQNVLGTVTSVNQGLLGAGGLLGGGGLLSYGGIFSLVEELSGLKIEELTLPKVSL
FT                   KLLPGVGVQLNLHTKVSLHGSGPLVGLLQLAAEVNVSSKVALGMSPRGTPILVLKRCST
FT                   LLGHISLMSGLLPTPIFGLVEQTLCKVLPGLLCPVVDSVLSVVNELLGATLSLVPLGPL
FT                   GSVEFTLATLPLISNQYIELDINPIVKSIAGDVIDFPKPRIPVKVPPKEDHTSQVTVPL
FT                   YLFSTVFGLLQTNGALDLDITPEMVPRNVPLTTTDLAALAPEALGKLPPAQHLLLSLRV
FT                   TKSPMVLLQNKKATVSIPVTIHVLSSVPQGTPVALFQLNGVMTLNAHLAPSSTKLHISL
FT                   SLERLSVQLASSFPQPFDASRLEEWLSDVVRAAYMQRLNEHLEVGIPLPKILNVNFANS
FT                   VVDIIENAVVLTVAP"
FT   misc_difference 1822..1842
FT                   /gene="Rya3"
FT                   /note="polyA tail: 21 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1842 BP; 366 A; 540 C; 484 G; 452 T; 0 other;
     cccagcccct ggctttcctt gcagaagaaa ggcttaattc aggccctcgg ggaaaaccgc        60
     aatttgctcc tgacttgaca tactgacggg ttcctggcgg ctgtgccccc tttgtctccc       120
     caagctgctg tgtgcagctg atgatgctgg gtgtgtatac cctgcttctg ctctggggcc       180
     tggccactcc atgcctgggg ctgcttgaga cagtgggcac gcttgctcgg attgacaagg       240
     atgaactggg caaagccatc cagaactccc tagttggggg ccctattctg caaaacgtgc       300
     tggggactgt gacatcagtg aaccagggcc tcctgggtgc aggagggctg ctcggaggtg       360
     gtggcctgct gagttacggt ggcatcttta gtcttgtgga agaactctct gggctgaaga       420
     tagaggaact aactttgccc aaagtgtcac tcaagctgct gccgggggtc ggggtgcagc       480
     tgaacctgca caccaaggtt agcctgcatg gctccggtcc cctggtgggc ctcctgcagc       540
     tggccgcaga ggtgaacgtg tcttcgaaag tggcactggg catgagtcct cgggggacac       600
     ccatccttgt ccttaagcgc tgcagcacgc tcctgggtca catcagtctg atgtcagggc       660
     tgctgcccac gccaatcttt gggctcgtag aacagacact gtgcaaggtg ctgcctggac       720
     tgctgtgccc tgtggtagac agtgtgctga gtgtggtgaa tgagctcttg ggagctacgc       780
     tgagcctggt gccccttggg cctctggggt ctgtggagtt cactctggct acacttcccc       840
     taatctccaa ccagtacatt gagctggata taaatcccat cgtgaagagc atagctggag       900
     atgtcattga tttccccaag ccacgcatcc cagtcaaggt gccccccaaa gaggaccaca       960
     cctcccaagt gactgtccca ctctatctct tcagcaccgt gtttgggctc ctgcaaacca      1020
     acggtgccct tgacctggac atcacccctg agatggttcc caggaatgtc cctctgacaa      1080
     ctactgacct ggcagctttg gctcctgagg ccctggggaa actgccccct gctcagcacc      1140
     tcctgctctc gctgcgggtg acaaaatcgc ccatggtcct gctgcagaac aagaaggcca      1200
     cagtctccat cccagtcacc atccatgtgc tgtcttctgt ccctcaagga actcctgtag      1260
     cccttttcca gttgaatggg gttatgactc taaatgccca cctggctcca tcctctacca      1320
     agctgcacat atctctgtcc ctggaacggc taagtgtcca gctggcctcc tcctttcccc      1380
     aaccttttga tgcatcccgt ctggaagaat ggctcagtga tgtggtccgg gctgcctaca      1440
     tgcagaggct caacgagcac ctggaggttg gaattcccct gcctaagatt ctcaatgtca      1500
     actttgccaa ttcagtggtc gatatcattg agaatgcagt tgtgctcaca gtggctccgt      1560
     gaggcggtat ggctgctgct ctccctgttc actacagagt cctatctgtc tgcccactct      1620
     gcctcagttt ccctcccagt cttaagcctg cattggtgac agtataagtg ccccttgccc      1680
     acccgggccc accttgccct ctgttcctgt gatcatgcct gttttggggt ggggatggct      1740
     ggatagccac tgatctgctt cagaaagcac atagcacctt ggttcaatcc cagctttaat      1800
     aaactgatcc ttggtcttgt gaaaaaaaaa aaaaaaaaaa aa                         1842
//