spacer

EBI Dbfetch

ID   BC047151; SV 1; linear; mRNA; STD; MUS; 3432 BP.
XX
AC   BC047151;
XX
DT   25-FEB-2003 (Rel. 74, Created)
DT   27-MAY-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus heparan sulfate 6-O-sulfotransferase 2, mRNA (cDNA clone
DE   IMAGE:6441977), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3432
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3432
RA   Strausberg R.;
RT   ;
RL   Submitted (21-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 04adaabbbe88953a1adb1ed3c4d1c2c6.
DR   Ensembl-Gn; ENSMUSG00000062184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114871; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: j Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 7657189.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3432
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="IMAGE:6441977"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1609
FT                   /codon_start=2
FT                   /gene="Hs6st2"
FT                   /product="Hs6st2 protein"
FT                   /db_xref="GOA:Q80UW0"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR010635"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1354959"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UW0"
FT                   /protein_id="AAH47151.1"
FT                   /translation="LAGALRAPLFALLPRGRRRRMHDLRRRWDLGSLCRALLTRGLAAV
FT                   GHSLKHVLSAIFSKIFGPLASVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLL
FT                   RLQAFSSPVPDPYRSEDESSARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGT
FT                   TFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSC
FT                   VPAVVDGKRDARLRPSRNFHYITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTS
FT                   EELPSCYTGDDWSGCPLKEFMDCPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVL
FT                   LESAKSNLKHMAFFGLTEFQRKTQYLFEKTFNMNFISPFTQYNTTRASSVEINEEIQKR
FT                   IEGLNFLDMELYSYAKDLFLQRYQFMRQKEHQDARRKRQEQRKFLKGRFLQTHFQSQSQ
FT                   GQSQSQSPGQNLSQNPNPNPNQNLTQNLSHNLTPSSNPNSTQRENRGSQKQGSGQGQGD
FT                   SGTSNGTNDYIGSVETWR"
XX
SQ   Sequence 3432 BP; 982 A; 769 C; 776 G; 905 T; 0 other;
     cttggcggga gccttgcgcg ccccgctctt cgcgctgctg cctcgaggcc gccgcaggcg        60
     gatgcacgac ctcaggcgac gctgggacct gggctccctc tgccgggccc tgctcactcg       120
     gggcctggca gccgtgggcc actcgctcaa gcacgtgctc agtgcgatct tctccaagat       180
     tttcggtccc ttggccagcg tcgggaacat ggatgagaaa tctaacaagc tgctgctggc       240
     tttggtgatg ctcttcctat ttgcggtgat cgtcctccaa tacgtgtgcc ccggcacaga       300
     atgccagctc ctccgcctgc aggcgttcag ctccccggtg ccggatccgt accgctcgga       360
     ggatgagagt tcggccaggt ttgtaccccg ctacaatttc agccgcggcg atctcctgcg       420
     caaggtagac ttcgacatca agggcgatga cctgatcgtg ttcctgcaca tccagaagac       480
     tgggggcacc acttttggcc gtcacctggt gcgcaacatc cagctggagc agccatgtga       540
     gtgccgcgtg gggcagaaga aatgcacttg ccaccggccg ggtaagaggg agacctggct       600
     cttctccagg ttctccaccg gctggagctg cgggctgcat gccgactgga ccgagctcac       660
     cagctgcgtg ccggcggtgg tggatggcaa gcgcgacgcc aggctgagac cttccaggaa       720
     cttccattac attaccatcc tgagagaccc agtgtcacgg tacttgagtg aatggaggca       780
     tgtccagaga ggagcaactt ggaaagcatc cctgcacgtc tgtgatggaa ggcccccaac       840
     ctctgaagag ctgcccagct gctacaccgg tgatgactgg tctggatgcc ctctcaaaga       900
     gttcatggac tgtccctata atctggccaa caaccgccaa gttcgcatgc tatctgacct       960
     gactctagtg ggatgctaca acctctctgt catgcctgaa aagcaaagaa acaaagtcct      1020
     tctggaaagt gccaaatcca atctgaagca catggcgttc tttggcctca ctgagtttca      1080
     gcgcaagacc cagtacctgt ttgagaagac cttcaacatg aactttatct cgccgtttac      1140
     ccagtataat accactaggg cctctagtgt tgagatcaat gaggaaatcc aaaagcgtat      1200
     tgagggactg aattttctgg atatggagtt gtacagctat gctaaagacc tctttctgca      1260
     aaggtatcag ttcatgaggc agaaagaaca tcaggatgcc aggcggaagc gtcaggagca      1320
     acgcaaattt ctgaagggaa ggttccttca gacccatttc cagagtcaga gtcagggtca      1380
     gagccagagc cagagtccag gtcagaatct gagtcagaat ccaaatccta acccaaatca      1440
     gaacctgact cagaacctga gtcacaatct gactccgagt tcaaatccca attcgaccca      1500
     gagggagaac cggggaagtc agaagcaggg ctcaggccag ggacaaggtg atagcggcac      1560
     cagcaatggc accaatgact acatagggag cgtagagaca tggcgctaac tggcactcaa      1620
     aggcttgtgc acactgcttc ccaaagcatc accaaaaaga tggcgtgtat cttacaagat      1680
     gaaaatgtcc aaacacatcc tgcttccttc atttgggaag ttcaaaaaaa aaaagtgtag      1740
     acgttgcctt tacagttgcc ttttgattca gtgttatgct gtgtgtgggt acaacaaatc      1800
     tcagtgtgta attaaattgt ctgttttggg atgaactact tctgaaatcc aagagccaaa      1860
     ccagactcac cagaaattgc agcttagata ttttaagacg ttcttaaatt aggtatggga      1920
     gacacaaaga aaacatgaaa tgtggccgtt taaacttatg gctaagaaac agactttaag      1980
     tgattccgga tactctgtta aaacccagtc ttgaaagcac cccccctccc tgcagggaag      2040
     tataagtaaa aacatgaaca gaactaaaag acactcaaaa ctgttcattt ccttgtttta      2100
     acaaggagcc tatttaaaca gaaaaacaac tgatgataaa ttttgccaaa ctgtagaaaa      2160
     taaacaattt ctcacttaaa tgtagctggg tttatgtaaa aataatggct tttcaaatag      2220
     atcgggattc gtgtcttgta acttaacaga tgtttaaaat ttagaatttt tctaccttct      2280
     gctgattaaa aggttttaaa cagggtatat ctcatattaa caaagcattt tttccaaatg      2340
     gaataccaat ggaaagatcc agtttccaga tggtttctgg gcactgtaat tccaacaatt      2400
     tcgatctttt tggcgctgct tctcattcac tttaaggctt ctccgagttg tgctcattcc      2460
     aaatgaatcc atgtatagaa tttttcttct tcatctaaac aacgtgttgc taaatctctt      2520
     gtgctattta atcctggact aaagtcagga ctttctatag aattgtctta tcaatgtctg      2580
     tgtagtaagg tccttaagaa gaactctcaa acagaataat ttgtctctta atattgctga      2640
     agttattatt cttcatcaga ttgaactaaa cctgaatgtg aactgttaat tatcttgttt      2700
     attgtaatgt ttccagtttg gctggctatt tctggcccat ggttcttttc ttgtattgac      2760
     agatttgtac acaataataa gagcaaaaaa ttttctcaaa gacaacagta gactaatcat      2820
     taagatagcc agagttgctc aataacacca aaagctgcct cttgataatt gaggggaaca      2880
     cttctaccag gattttgttt gtgaaagatc aaaaataaag aatgttttgc agcgaagcta      2940
     agtgtcaggg acgtgcaagt agaggagaat agtttgatag tctgcatctg tgaagagtat      3000
     tttgatggtt tcaattacaa atggaacaaa ggaagaatta tatacacact gtgttgtgaa      3060
     atatcatact gcttggcagt ttacacctca tggttgttgc tacacttcta taagagctta      3120
     cattaatccc ttggctttca atcaaaacaa ggtgaccaga agtggtattc atgctttcaa      3180
     gagggacatg cttagaaata tgatcataaa gtcacatctg tcatagtctg cccaagtgca      3240
     tgacctggtt tcatctgtaa taatatggcc acaagtttgg caagaagttg agtatctggc      3300
     tctaaagaga ttttcttgac tctgagctct gtgacaatat ttgcagcttt tgttttgtgg      3360
     tatttgcagt gttgagaatg atgataccta aaaaaaaaat caaaaaacaa aaacaaaaaa      3420
     aaaaaaaaaa aa                                                          3432
//


spacer
spacer