Dbfetch

ID   BC047146; SV 1; linear; mRNA; STD; MUS; 3958 BP.
XX
AC   BC047146;
XX
DT   25-FEB-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus neurexin I, mRNA (cDNA clone MGC:54438 IMAGE:6466916),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3958
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3958
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (21-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 21aa5b3bf53986754adcecc3a94a08ea.
DR   Ensembl-Gn; ENSMUSG00000024109; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024115; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024075; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024044; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023841; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024521; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023320; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023943; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023909; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024027; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023937; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024566; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023065; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023386; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161402; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197268; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048807; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0048784; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0048744; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048746; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049238; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048570; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0048416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0048518; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0048487; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0048635; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048491; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049338; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048169; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047792; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: j Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 30794485.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3958
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:54438 IMAGE:6466916"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3958
FT                   /gene="Nrxn1"
FT                   /note="synonym: mKIAA0578"
FT   misc_difference 1..83
FT                   /gene="Nrxn1"
FT                   /note="83 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             213..3743
FT                   /codon_start=1
FT                   /gene="Nrxn1"
FT                   /product="Nrxn1 protein"
FT                   /db_xref="GOA:Q9CS84"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="InterPro:IPR029824"
FT                   /db_xref="MGI:MGI:1096391"
FT                   /db_xref="PDB:3BOD"
FT                   /db_xref="PDB:3MW2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CS84"
FT                   /protein_id="AAH47146.1"
FT                   /translation="MLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDN
FT                   AWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN
FT                   NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFI
FT                   SLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHL
FT                   YLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDL
FT                   DDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGV
FT                   KPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFM
FT                   KIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIR
FT                   INCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFH
FT                   NIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIA
FT                   DPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLH
FT                   YVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDL
FT                   KSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCE
FT                   GPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWP
FT                   PNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIA
FT                   IEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRL
FT                   GRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDAN
FT                   IAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQ
FT                   TTDDILVASAECPSDDEDIDPCEPSSANPTRVGGREPYPGSAEVIRESSSTTGMVVGIV
FT                   AAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKN
FT                   KKNKDKEYYV"
FT   misc_difference 3955..3958
FT                   /gene="Nrxn1"
FT                   /note="4 bases at the 3' end do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3958 BP; 1177 A; 906 C; 953 G; 922 T; 0 other;
     ggaaaacaga ccaaccatct gcatctagac cagccttcct ctccctcgct cccttttaga        60
     ggaggttttc ctgcctggaa tctggaaaag aagagtatat tgccacgttc aagggatctg       120
     aatacttctg ctacgactta tctcaaaacc ccattcaaag cagcagtgat gaaataactc       180
     tgtcctttaa aactcttcaa aggaacggac tgatgcttca cacagggaaa tcagctgatt       240
     atgtcaatct tgcattgaaa aatggagctg tctctctggt cattaatttg ggatcagggg       300
     cctttgaagc actagtggag cctgtgaatg gaaagtttaa tgataatgcc tggcatgatg       360
     tgaaagtcac caggaatctg cgtcaggtga caatatcagt ggatggaatt cttaccacaa       420
     cgggctacac gcaagaagat tacaccatgc tggggtctga tgactttttc tatgttggag       480
     gcagccccag cacagccgac cttccagggt caccagtcag taacaacttt atgggctgtc       540
     tcaaagaggt tgtatataaa aataatgatg taaggctgga attatcgcga cttgccaagc       600
     aaggagatcc taagatgaag attcacggtg tggtggcttt taagtgtgaa aatgtggcaa       660
     ccttagaccc aataactttt gagaccccgg aatctttcat ttctttgcct aagtggaatg       720
     caaagaaaac aggctcaata tcatttgatt tccgtacaac ggagccaaat ggcctcatcc       780
     tgtttagcca tggcaagcca agacatcaga aggatgccaa gcacccacag atgattaagg       840
     ttgacttttt tgctattgag atgctggatg gccacttgta cctcctctta gacatgggat       900
     caggtactat aaaaatcaaa gccctgcaga agaaagtcaa tgatggagaa tggtatcacg       960
     tggatttcca acgggatgga cggtcaggta ccatttctgt caacacacta cgcactccct      1020
     acacagctcc cggtgagagt gagatcctgg acctagatga tgagttgtac ctgggtggct      1080
     tgccagaaaa taaggctggc ctagtcttcc ctaccgaggt gtggactgct ctgctcaact      1140
     acggctacgt gggctgcatc cgggacctat ttattgatgg ccagagcaaa gacatccggc      1200
     agatggcgga aattcagagc actgctggag tgaagccatc ctgctcaaaa gagacagcaa      1260
     aaccgtgcct tagcaatcct tgcaaaaaca atggcatgtg cagagatggc tggaacagat      1320
     acgtctgcga ttgctccgga acaggctatc tcggcaggtc ctgtgagaga gaggcaacgg      1380
     ttttgagcta cgacgggagc atgttcatga aaatccagct tccggtggtg atgcacactg      1440
     aggctgagga cgtgtccttg cggttccgat cccagcgtgc atatggtatc ctgatggcga      1500
     ccacttctag agactctgca gacacccttc gattggagct agatgcagga cgtgtgaaac      1560
     tcacggtcaa tctagattgt atcaggatta actgtaattc cagcaaaggt cctgagaccc      1620
     tttttgctgg ctataacctc aatgataatg aatggcacac agtgcgtgtg gttcggcgag      1680
     gaaaaagttt aaagctaacc gtggatgatc aacaagccat gacaggccaa atggcaggtg      1740
     atcatacaag gctggagttt cataacatag agacaggcat catcaccgaa cgacgctacc      1800
     tttcttctgt cccctccaat ttcattgggc acctgcaaag cctgacattt aatggaatgg      1860
     catacataga cttgtgcaaa aatggtgata tagattactg tgaactcaat gccaggtttg      1920
     gattcaggaa catcatcgca gatcctgtca ccttcaagac caaatcgagc tatgttgcct      1980
     tagctacatt gcaagcctac acctctatgc atctattttt ccaattcaag acaacatctc      2040
     tagatggact aattctgtat aacagtgggg atggaaatga ctttattgtg gttgaattag      2100
     ttaaagggta cttacattat gtgtttgact tgggaaacgg tgctaacctc atcaaaggga      2160
     gctcaaacaa accactcaac gacaatcagt ggcacaatgt gatgatttca cgggacacca      2220
     gcaatctcca cacagtaaag atcgacacaa aaatcacaac acaaatcact gcgggagcca      2280
     gaaatctaga cctcaagagt gacttgtata ttggaggagt ggctaaagaa acatataaat      2340
     ccctgccaaa actggtccat gccaaagaag gctttcaagg ttgcctggca tctgtggact      2400
     tgaatggcag acttccagat ctcatctcgg atgctctctt ctgcaatggg caaattgaga      2460
     gaggatgcga agggcccagc acaacctgcc aagaggattc atgttcaaat caaggcgttt      2520
     gcttgcagca atgggatggc ttcagctgtg actgtagcat gacttccttc agtggcccac      2580
     tctgcaatga ccctgggaca acatatatct ttagcaaagg tggtggacag attacatata      2640
     agtggcctcc caatgaccgc cccagtacac gagcagacag gctggccatc ggatttagca      2700
     ctgtccagaa ggaagccgtg ttggtgcgtg tggacagttc ctcaggactg ggtgactacc      2760
     tggagctgca catacaccaa ggaaaaattg gagttaagtt taatgttggg acagatgaca      2820
     tcgccatcga agagtctaat gcaatcatta atgatgggaa ataccatgta gtacgtttca      2880
     caaggagtgg tggcaatgcc acgttacagg tggacagctg gccagttatc gaacgctacc      2940
     ctgcaggaaa caatgataac gagcgcctgg cgattgctag acagcgaatt ccatatcgac      3000
     ttggtcgagt agttgatgaa tggctactcg acaaagggcg tcagctcaca atcttcaata      3060
     gccaagcaac cataataatt ggcgggaaag agcagggcca gcccttccag ggccagctct      3120
     ctggtcttta ctacaatggc ttgaaagttc tgaatatggc agcagagaac gatgccaaca      3180
     tcgccatagt ggggaatgtg aggctggtcg gtgaagtgcc ttcctctatg acaactgagt      3240
     cgacagccac tgccatgcag tctgagatgt ccacctcaat catggagacc accacaaccc      3300
     tggctaccag cacagctaga agaggcaagc cccccacaaa ggaacccatc agccagacca      3360
     cagatgacat ccttgtggcc tcggcagagt gtcccagtga cgatgaggac attgacccct      3420
     gtgagccgag ctcagccaac cccaccagag taggtggccg tgaaccatac ccaggctctg      3480
     cagaggtgat tcgggagtcc agcagtacca ctggcatggt ggtggggatt gtcgcagcag      3540
     ccgctctgtg catcctcatc ctcctctatg ccatgtacaa gtacaggaac cgggatgaag      3600
     ggtcgtacca cgtggatgag agtcgaaact acatcagtaa ctcagcacag tccaatgggg      3660
     ctgtggtcaa ggagaagcaa cccagcagtg ctaaaagcgc caacaaaaac aagaaaaaca      3720
     aggataagga gtattacgtc tgatatcaag atttgaaacg gacacttgta tagaaatagt      3780
     cttcatttta tctgagacat aatataaact tttactttcc tttttatgaa gcacatacaa      3840
     aagaagacag ggaatgcgat caggagggaa aactcttttt aaaaaaaaaa acaaacaagt      3900
     atctcatgct cttgtttctc aaaagaaaaa aaaaacatac acaaaaaaaa aaaaaaaa        3958
//