spacer

EBI Dbfetch

ID   BC046991; SV 1; linear; mRNA; STD; MUS; 3185 BP.
XX
AC   BC046991;
XX
DT   24-FEB-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus matrix metallopeptidase 9, mRNA (cDNA clone MGC:54599
DE   IMAGE:6309245), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3185
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3185
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (14-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e1a55ac0b3f2d4ef5d71bd81770a95d3.
DR   Ensembl-Gn; ENSMUSG00000017737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017881; mus_musculus.
DR   EuropePMC; PMC2906514; 20657842.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: b Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31560795.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3185
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:54599 IMAGE:6309245"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3185
FT                   /gene="Mmp9"
FT                   /note="synonyms: MMP-9, B/MMP9, protease, zymogen,
FT                   pro-MMP-9"
FT   CDS             7..2199
FT                   /codon_start=1
FT                   /gene="Mmp9"
FT                   /product="matrix metallopeptidase 9"
FT                   /db_xref="GOA:P41245"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="MGI:MGI:97011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41245"
FT                   /protein_id="AAH46991.1"
FT                   /translation="MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQL
FT                   AEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPD
FT                   VGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPE
FT                   ADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYY
FT                   GNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHG
FT                   NGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGG
FT                   NSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVA
FT                   AHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTT
FT                   TEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTA
FT                   GSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTAR
FT                   TWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLL
FT                   PRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHG
FT                   KFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP"
FT   misc_difference 3140..3185
FT                   /gene="Mmp9"
FT                   /note="polyA tail: 46 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3185 BP; 723 A; 929 C; 806 G; 727 T; 0 other;
     ctcaccatga gtccctggca gcccctgctc ctggctctcc tggctttcgg ctgcagctct        60
     gctgcccctt accagcgcca gccgactttt gtggtcttcc ccaaagacct gaaaacctcc       120
     aacctcacgg acacccagct ggcagaggca tacttgtacc gctatggtta cacccgggcc       180
     gcccagatga tgggagagaa gcagtctcta cggccggctt tgctgatgct tcagaagcag       240
     ctctccctgc cccagactgg tgagctggac agccagacac taaaggccat tcgaacacca       300
     cgctgtggtg tcccagacgt gggtcgattc caaaccttca aaggcctcaa gtgggaccat       360
     cataacatca catactggat ccaaaactac tctgaagact tgccgcgaga catgatcgat       420
     gacgccttcg cgcgcgcctt cgcggtgtgg ggcgaggtgg cacccctcac cttcacccgc       480
     gtgtacggac ccgaagcgga cattgtcatc cagtttggtg tcgcggagca cggagacggg       540
     tatcccttcg acggcaagga cggccttctg gcacacgcct ttccccctgg cgccggcgtt       600
     cagggagatg cccatttcga cgacgacgag ttgtggtcgc tgggcaaagg cgtcgtgatc       660
     cccacttact atggaaactc aaatggtgcc ccatgtcact ttcccttcac cttcgaggga       720
     cgctcctatt cggcctgcac cacagacggc cgcaacgacg gcacgccttg gtgtagcaca       780
     acagctgact acgataagga cggcaaattt ggtttctgcc ctagtgagag actctacacg       840
     gagcacggca acggagaagg caaaccctgt gtgttcccgt tcatctttga gggccgctcc       900
     tactctgcct gcaccactaa aggccgctcg gatggttacc gctggtgcgc caccacagcc       960
     aactatgacc aggataaact gtatggcttc tgccctaccc gagtggacgc gaccgtagtt      1020
     gggggcaact cggcaggaga gctgtgcgtc ttccccttcg tcttcctggg caagcagtac      1080
     tcttcctgta ccagcgacgg ccgcagggat gggcgcctct ggtgtgcgac cacatcgaac      1140
     ttcgacactg acaagaagtg gggtttctgt ccagaccaag ggtacagcct gttcctggtg      1200
     gcagcgcacg agttcggcca tgcactgggc ttagatcatt ccagcgtgcc ggaagcgctc      1260
     atgtacccgc tgtatagcta cctcgagggc ttccctctga ataaagacga catagacggc      1320
     atccagtatc tgtatggtcg tggctctaag cctgacccaa ggcctccagc caccaccaca      1380
     actgaaccac agccgacagc acctcccact atgtgtccca ctatacctcc cacggcctat      1440
     cccacagtgg gccccacggt tggccctaca ggcgccccct cacctggccc cacaagcagc      1500
     ccgtcacctg gccctacagg cgccccctca cctggcccta cagcgccccc tactgcgggc      1560
     tcttctgagg cctctacaga gtctttgagt ccggcagaca atccttgcaa tgtggatgtt      1620
     tttgatgcta ttgctgagat ccagggcgct ctgcatttct tcaaggacgg ttggtactgg      1680
     aagttcctga atcatagagg aagcccatta cagggcccct tccttactgc ccgcacgtgg      1740
     ccagccctgc ctgcaacgct ggactccgcc tttgaggatc cgcagaccaa gagggttttc      1800
     ttcttctctg gacgtcaaat gtgggtgtac acaggcaaga ccgtgctggg ccccaggagt      1860
     ctggataagt tgggtctagg cccagaggta acccacgtca gcgggcttct cccgcgtcgt      1920
     ctcgggaagg ctctgctgtt cagcaagggg cgtgtctgga gattcgactt gaagtctcag      1980
     aaggtggatc cccagagcgt cattcgcgtg gataaggagt tctctggtgt gccctggaac      2040
     tcacacgaca tcttccagta ccaagacaaa gcctatttct gccatggcaa attcttctgg      2100
     cgtgtgagtt tccaaaatga ggtgaacaag gtggaccatg aggtgaacca ggtggacgac      2160
     gtgggctacg tgacctacga cctcctgcag tgcccttgaa ctagggctcc ttctttgctt      2220
     caaccgtgca gtgcaagtct ctagagacca ccaccaccac caccacacac aaaccccatc      2280
     cgagggaaag gtgctagctg gccaggtaca gactggtgat ctcttctaga gactgggaag      2340
     gagtggaggc aggcagggct ctctctgccc accgtccttt cttgttggac tgtttctaat      2400
     aaacacggat ccccaacctt ttccagctac tttagtcaat cagcttatct gtagttgcag      2460
     atgcatccga gcaagaagac aactttgtag ggtggattct gaccttttat ttttgtgtgg      2520
     cgtctgagaa ttgaatcagc tggcttttgt gacaggcact tcaccggcta aaccacctct      2580
     cccgactcca gcccttttat ttattatgta tgaggttatg ttcacatgca tgtatttaac      2640
     ccacagaatg cttactgtgt gtcgggcgcg gctccaaccg ctgcataaat attaaggtat      2700
     tcagttgccc ctactggaag gtattatgta actatttctc tcttacattg gagaacacca      2760
     ccgagctatc cactcatcaa acatttattg agagcatccc tagggagcca ggctctctac      2820
     tgggcgttag ggacagaaat gttggttctt ccttcaagga ttgctcagag attctccgtg      2880
     tcctgtaaat ctgctgaaac cagaccccag actcctctct ctcccgagag tccaactcac      2940
     tcactgtggt tgctggcagc tgcagcatgc gtatacagca tgtgtgctag agaggtagag      3000
     ggggtctgtg cgttatggtt caggtcagac tgtgtcctcc aggtgagatg acccctcagc      3060
     tggaactgat ccaggaagga taaccaagtg tcttcctggc agtctttttt aaataaatga      3120
     ataaatgaat atttacttaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3180
     aaaaa                                                                  3185
//


spacer
spacer