spacer

EBI Dbfetch

ID   BC046958; SV 1; linear; mRNA; STD; MUS; 2611 BP.
XX
AC   BC046958;
XX
DT   20-FEB-2003 (Rel. 74, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 9)
XX
DE   Mus musculus forkhead box G1, mRNA (cDNA clone MGC:54714 IMAGE:6314329),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2611
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2611
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (14-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d1bcdd2e3f05e22ea5bb14747bb00fff.
DR   Ensembl-Gn; ENSMUSG00000020950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179669; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: e Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6679842.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2611
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:54714 IMAGE:6314329"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2611
FT                   /gene="Foxg1"
FT                   /note="synonyms: BF-1, Hfh9, Bf1"
FT   CDS             204..1649
FT                   /codon_start=1
FT                   /gene="Foxg1"
FT                   /product="forkhead box G1"
FT                   /db_xref="GOA:Q60987"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="MGI:MGI:1347464"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60987"
FT                   /protein_id="AAH46958.2"
FT                   /translation="MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHP
FT                   QHHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPP
FT                   STALDGAKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKE
FT                   GDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIR
FT                   HNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRG
FT                   ARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQN
FT                   SLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSV
FT                   NLLAGQTSYFFPHVPHPSMTSQTSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTG
FT                   LSGGLSDYFTHQNQGSSSNPLIH"
FT   misc_difference 2574..2611
FT                   /gene="Foxg1"
FT                   /note="polyA tail: 38 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2611 BP; 626 A; 788 C; 639 G; 558 T; 0 other;
     cttgaggggt ggttgcagct tttgctacat gccttgccag cgccggagcc tgcggtccaa        60
     ctgcgctgct gccggagcgc tcagtgccgc ctccgctgcc cgctcccccc gcgccccact       120
     ccgaacccgc tggtcgcccg ccgcgctgct gcccggctcc cgtgccgccg ccgccgccgc       180
     cgccgccccc cgacgcctgg gtgatgctgg acatgggaga taggaaagag gtgaaaatga       240
     ttcccaagtc ctcgttcagc atcaacagcc tggtccccga ggccgtccag aacgacaacc       300
     accacgcgag ccacggccac cacaacagcc accaccccca gcatcaccat catcatcacc       360
     accaccacca cccgccgccg cccgcgcccc agccgcctcc accgccgccc cagcagcagc       420
     agcagcagcc gcccccggcc ccgcagcccc cgcaggcgcg cggcgcccca gcagccgacg       480
     acgacaaggg tccccagccg ctcctgctcc cgccctccac cgccctggac ggggccaagg       540
     ctgacgcact tggagccaaa ggcgagccgg gcggcgggcc ggcggagctg gcgcccgtcg       600
     ggccggacga gaaggagaag ggcgcgggcg ccggggggga ggagaagaaa ggggcgggcg       660
     agggcggcaa ggacggggag gggggcaagg agggcgacaa gaagaacggc aagtacgaga       720
     agccgccgtt cagctacaac gcgctcatca tgatggccat caggcagagt cccgagaagc       780
     gcctgacgct caatggcatc tatgagttca tcatgaagaa cttcccctac taccgcgaga       840
     acaagcaggg ctggcagaac tccatccgcc acaacctgtc cctcaacaag tgcttcgtga       900
     aggtaccgcg ccactacgac gacccgggca agggcaacta ctggatgctc gacccgtcga       960
     gcgacgacgt gttcatcggc ggcacgaccg gcaagctgcg gcgccgctcc accacgtctc      1020
     gggccaagct ggcctttaag cgcggggcgc gcctcacctc caccggcctc accttcatgg      1080
     accgcgccgg ctccctctac tggcccatgt cgcccttcct gtccctgcac cacccccgcg      1140
     ccagcagcac tttgagttac aacgggacca cgtcggccta ccccagccac cccatgccct      1200
     acagctccgt gttgactcaa aactcgctgg gcaacaacca ctccttctcc accgccaacg      1260
     ggctgagtgt ggaccggctg gtcaacgggg agatcccgta cgccacgcac cacctcacgg      1320
     ccgctgcgct cgccgcctcg gtgccctgcg gcctgtcggt gccctgctcc gggacctact      1380
     ccctcaaccc ctgctccgtc aacctgctcg cgggccagac cagttacttt ttcccccacg      1440
     tcccgcaccc gtcaatgact tcgcagacca gcacgtccat gagcgcccgg gccgcgtcct      1500
     cctctacgtc gccgcaggcc ccctcgaccc tgccctgtga gtctttaaga ccctctttgc      1560
     caagttttac gacaggactg tccgggggac tgtctgatta tttcacacat caaaatcagg      1620
     ggtcttcttc caacccttta atacattaac atccggggga ccagactgta agtgaacgtt      1680
     ttacacacat ttgcattgta aatgataatt aaaaaaataa gtccaggtat tttttattaa      1740
     gccccccctc cccatttctg tacgtttgtt cagtctttag ggttgtttac tattctaaca      1800
     cggtgtggag tgtcagcgag gtgcaatgtg ggagaataca ttgtagaata taaggtttgg      1860
     acgtcaaatt atagtagaat gtgtatctaa atagtgactg ctttgccatt tcattcaaac      1920
     ctgacaagtc tatctcaaca ggctgccaga tttccatgtg tgcagtatta taagttatca      1980
     tggagctatc tggtggacgc aggccttgag aacaacctaa attatgaaga gagttttaaa      2040
     atgttaaatt gtaatttgta tttaagaatt tgtagtaaag gtgcccaagg aattatattg      2100
     gccatttatt gttttgtcct ttttctttaa agaactgttt ctttcctttt gtttactttt      2160
     agaccaaaga ttggattcta gcaaatgcac ttggtatact aagtattaaa acaagtaaac      2220
     aaacaaacga aaaaggaagg ttgtttagtt ggcaacactg cccattcaat tgaatccgaa      2280
     ggagacaaaa ttaaggattg ccttcagttt gtgttgtgta tatttcgatg tatgtggtca      2340
     ctaacaggtc acttttattt tttctaaatg tagtgaaatg ttaataccta ttgtacttat      2400
     aggtaaacct tgcaaatatg taacctgtgt tgcgcaaatg ccgcatcaat ttgagtgatt      2460
     gttaatgttg tcttaaaatt tcttgattgt gatactgtgg tcatatgccc gtgtttgtca      2520
     cttacaaaaa tgtttactat gaacacacag aaataaaaaa taggctaaat tcaaaaaaaa      2580
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a                                     2611
//


spacer
spacer