Dbfetch

ID   BC046832; SV 1; linear; mRNA; STD; MUS; 2785 BP.
XX
AC   BC046832;
XX
DT   22-MAR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus protein phosphatase 1, catalytic subunit, beta isoform, mRNA
DE   (cDNA clone MGC:61405 IMAGE:6812937), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2785
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2785
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 62eab215896414d364921c310538a59b.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029435; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029401; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029412; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029865; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028543; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029101; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029250; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029335; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029237; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029899; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028268; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028624; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201360; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070976; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071059; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070960; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070984; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070630; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071464; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071166; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070707; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070617; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070780; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070642; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071660; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070636; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069787; mus_musculus_wsbeij.
DR   EuropePMC; PMC1553470; 16822311.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 28173567.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2785
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FW0"
FT                   /clone="MGC:61405 IMAGE:6812937"
FT                   /tissue_type="Brain, mouse, 13.5, 14.5, 16.5, 17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2785
FT                   /gene="Ppp1cb"
FT                   /note="synonym: 1200010B19"
FT   CDS             88..1071
FT                   /codon_start=1
FT                   /gene="Ppp1cb"
FT                   /product="protein phosphatase 1, catalytic subunit, beta
FT                   isoform"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="AAH46832.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
FT   misc_difference 1751^1752
FT                   /gene="Ppp1cb"
FT                   /note="1 base in the mouse genome, G, is not found in
FT                   cDNA."
FT   misc_difference 2337^2338
FT                   /gene="Ppp1cb"
FT                   /note="1 base in the mouse genome, T, is not found in
FT                   cDNA."
FT   misc_difference 2477
FT                   /gene="Ppp1cb"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2763..2785
FT                   /gene="Ppp1cb"
FT                   /note="polyA tail: 23 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2785 BP; 813 A; 463 C; 564 G; 945 T; 0 other;
     cgtgactcgt aggtgagaac gccgagccgc cgccgccgcc gagaagccct gttaacgctt        60
     tagggaggag agtctggtgc cgacaagatg gcggacgggg agctgaacgt ggacagcctc       120
     atcacccgcc tgctggaggt acgaggatgt cgtccaggaa agattgtaca aatgactgaa       180
     gcagaagtcc gagggttgtg tatcaagtct cgtgaaatct ttctcagcca gcctattctt       240
     ttggaattgg aagcaccact gaagatttgt ggagacattc atggacaata tacagactta       300
     ctaagattat ttgaatatgg aggttttcca ccagaagcca actatctttt cttaggagat       360
     tatgtggaca gaggaaagca gtctttggaa accatctgtt tgctattggc ttacaaaatc       420
     aaatacccgg agaacttctt tcttctaaga ggaaaccatg agtgtgctag catcaatcgc       480
     atttatggat tctacgatga gtgtaaacga agatttaata ttaaattgtg gaagacattc       540
     actgattgtt ttaactgtct gcctatagct gctattgttg atgagaaaat cttctgttgt       600
     catggaggac tgtcaccaga cctacaatct atggaacaga ttcggagaat tatgagaccc       660
     actgacgtac ctgatacagg tttgctttgt gacttactgt ggtccgaccc agataaggat       720
     gtgcaaggct ggggagaaaa tgaccgtggt gtttctttta cttttggagc tgatgtagtc       780
     agtaaatttc tgaatcgtca tgatttagac ttgatttgtc gagctcatca ggtggtggaa       840
     gacggatatg aattttttgc taaacgacag ttggtaacct tattttctgc cccaaattac       900
     tgtggcgagt ttgacaatgc tggtggtatg atgagtgtgg atgagacttt gatgtgttca       960
     ttccagatat tgaaaccatc tgaaaagaaa gctaagtacc agtatggtgg gctgaattct      1020
     ggacgtcctg tcactccgcc tcgaacagct aatccaccga agaaaaggtg aagacaggaa      1080
     ttctagaaag agaaaccatc agatttgtta aggacatact tcataatata taagtgtgca      1140
     ctgtaaaacc atccagccat tcgacaccct ttatgatgtc acacctttaa cttaaggaga      1200
     cggtaaagga tcttaaattt ttttctaata gaaagatgtg ctacactgta ttgtaataag      1260
     tatactctgt tataatattc aacaaaatta aatccaaatt caaaagtatc cattaaagtt      1320
     ctatcttctc atatcacagt ttttaaagtt gaaaagcatc ccagttaaac tagccctgtt      1380
     agtgacccag atgaaagcat gaagatccat ctgtgtaatg tggttttagt ggtgcttggt      1440
     tgtttcatta ttttgagctt gttttgtttt gtttgttttt gctagaataa tggcatctac      1500
     ttttcctatt tttccctaaa catttttaaa agtgaaaatg ggaagagctt taaagacatt      1560
     caccaactat tcttttcctt tacttatcta cttaagtaac tgttggatct tactaagaaa      1620
     acttacccct cattacagta aaaaggaact ttagaggtcg ataggtttta aaaatataca      1680
     aactatctga tccattgatt ttaatcaaac agtttgactg ggcaaacttt gcagctgata      1740
     atgagtattt cctttttaca aaattgccac tgatttggat ttgtgcactc taatctttaa      1800
     tttattgatg ctctattgtg cagtagcatt tcatttaaga taaggctcat atagtaatat      1860
     ccaaaactag ttggtaatgt gattatgtgg tactttggct ttgggttcta attcgcacga      1920
     aacacctttt ggcatgctta actttctggt attaccctca cctgcattgg ttttgttttt      1980
     tggggttttt gttgtttgtt tgtttttaga ttcacagaac atgagaatcc tttttgacaa      2040
     gccttggata gctggctctc ttctttccct ctctctatgt gaaggatgta tttaaatgaa      2100
     cgctggtcag tgggacattt gtcagctctg aatattgggt gcttcactaa taattgccat      2160
     gtgaatgttg ttttgactgt aaggctatgt cactaaagat ttttactctg cgttttcata      2220
     atcaaaggtc atgatgtgta tagacatgct ttgtagtgaa gtatagtagc aataatttct      2280
     gtatgtgatc aagagtttat tgcattattt ctttccctgt tctctttttt tttttttaag      2340
     ggttagcatt aacaaatgtc aaggagtagc aaagtcaaca aagattttag aaggaggagg      2400
     aactaagagc atacacagac ttatgattct ttggatgtga cacttattgg atgtgattct      2460
     aaagtctttt attgaatatt gtcaaattcg tacgcttcat aggatggaca taatgtttat      2520
     ataatgccct tcttatgtgt taccatagat gtgtgaaacc ttatagcgtc cttgaaagtg      2580
     ttaaattgag aactctgtta acattttatg gattgacaca ttatattact gcaagtaaca      2640
     tttgattttc agcacagtgc aaaagttctt taaaatgcat atgtcttttt ttttctaatt      2700
     ccattttgtt taaagcacat tttaaatgta gttttctcat ttagtaaaag ttgtctaatt      2760
     gaaaaaaaaa aaaaaaaaaa aaaaa                                            2785
//