Dbfetch

ID   BC046778; SV 1; linear; mRNA; STD; MUS; 4413 BP.
XX
AC   BC046778;
XX
DT   17-FEB-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus Unc-51 like kinase 2 (C. elegans), mRNA (cDNA clone MGC:61227
DE   IMAGE:5709559), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4413
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4413
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 608d00ea85c94f1372d26e724b7b0173.
DR   Ensembl-Gn; ENSMUSG00000004798; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018447; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018416; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018386; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018387; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018200; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018839; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017757; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018174; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018283; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018274; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018356; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018298; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018880; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017530; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017809; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000004920; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0029595; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0029546; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0029520; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0029539; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029338; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0030038; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0029031; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029254; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029399; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029373; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0029508; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029359; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0030073; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0028738; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0028828; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982529.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4413
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EX0"
FT                   /clone="MGC:61227 IMAGE:5709559"
FT                   /tissue_type="Brain, mouse 15.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..4413
FT                   /gene="Ulk2"
FT                   /note="synonyms: Unc51.2, mKIAA0623"
FT   CDS             475..3588
FT                   /codon_start=1
FT                   /gene="Ulk2"
FT                   /product="Unc-51 like kinase 2 (C. elegans)"
FT                   /db_xref="GOA:Q9QY01"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016237"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="MGI:MGI:1352758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY01"
FT                   /protein_id="AAH46778.1"
FT                   /translation="MEVVGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKN
FT                   LSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLS
FT                   EDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFAR
FT                   YLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDL
FT                   RMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQVPVKKSCP
FT                   VPVPVYSGPVPGSSCSSSPSCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSAS
FT                   NSSKNSSCDTDDFVLVPHNISSDHSYDMPMGTTARRASNEFFMCGGQCQPTVSPHSETA
FT                   PIPVPTQVRNYQRIEQNLISTASSGTNPHGSPRSAVVRRSNTSPMGFLRVGSCSPVPGD
FT                   TVQTGGRRLSTGSSRPYSPSPLVGTIPEQFSQCCCGHPQGHEARSRHSSGSPVPQTQAP
FT                   QSLLLGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHAGAGYSYSPQPSRPGSLGTSPT
FT                   KHTGSSPRNSDWFFKTPLPTIIGSPTKTTAPFKIPKTQASSNLLALVTRHGPAESQSKD
FT                   GNDPRECSHCLSVQGSERHRSEQQQSKAVFGRSVSTGKLSEQQVKAPLGGHQGSTDSLN
FT                   TERPMDVAPAGACGVMLALPAGTAASARAVLFTVGSPPHSATAPTCTHMVLRTRTTSVG
FT                   SSSSGGSLCSASGRVCVGSPPGPGLGSSPPGAEGAPSLRYVPYGASPPSLEGLITFEAP
FT                   ELPEETLMEREHTDTLRHLNMMLMFTECVLDLTAVRGGNPELCTSAVSLYQIQESVVVD
FT                   QISQLSKDWGRVEQLVLYMKAAQLLAASLHLAKAQVKSGKLSPSMAVKQVVKNLNERYK
FT                   FCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQSAALDEMFQQTEDI
FT                   VYRYHKAALLLEGLSKILQDPTDVENVHKYKCSIERRLSALCCSTATV"
FT   misc_difference 4395..4413
FT                   /gene="Ulk2"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4413 BP; 1148 A; 1122 C; 1076 G; 1067 T; 0 other;
     cgctcccgcg aagcaggcag aagccgccac cgcggctgtg cgggttccag ggcggcggcc        60
     gctacacagc agcgccgcgg gcgcaacaag cggaggcagc cgcacctgcg gggatggcgc       120
     ggccccggcc ctgcaccgct gtcaggcgcg cgggtagctc cgggtacgcc cagtgacggc       180
     ggcggtgccc tcggccgggc agtgcccagg ccgcttggct agagccccgc ggccgacggc       240
     ggcccgggcc atgagaagcg accgggccca ggcctcgctg accccggctc cgcgcggcgg       300
     cccgtcccgt ttccgctccg gcctctcggc atgagtgtcc atccgggccc ggggccgtgg       360
     ctgcccctgt cccgccgccc gcgggcgtgc ttggggccct cgggcccgcg gtgctgatcc       420
     cggttctccg ccacgcctgc ccaccctagc gctctatgtc ccgggggcgc ggccatggag       480
     gtggtgggcg acttcgagta ctgcaagcgg gacctcgtgg gacacggggc cttcgctgtg       540
     gtcttccggg ggcggcaccg ccagaaaact gattgggagg tggctattaa aagtattaat       600
     aaaaagaact tgtcaaaatc acaaattctg cttggaaagg aaataaaaat cttaaaggag       660
     cttcagcatg aaaacatcgt agcgctctat gatgttcagg aattgcccaa ctctgtcttt       720
     ctggtgatgg agtattgcaa tggtggagac ctggcagatt atttgcaagc taaaggaact       780
     ctgagtgaag atactatcag agtgtttctc catcagattg cggcagccat gcgaatcctg       840
     cacagcaaag ggataatcca cagggatctc aaaccacaga atatcctgtt gtcttatgcc       900
     aatcgaagga agtcgaatgt cagtggtatt cgtattaaaa tagctgattt tggtttcgca       960
     cggtacctac atagtaacac aatggcagcg acactgtgtg gatccccaat gtacatggct      1020
     cccgaggtta ttatgtctca acattatgat gctaaggcag atttatggag cataggaaca      1080
     gtgatctatc aatgcctagt tggaaaacca ccttttcagg ctaatagtcc tcaggaccta      1140
     aggatgtttt atgaaaaaaa caggagctta atgcctagta ttcccagaga aacatcacct      1200
     tacttggcta atctcctttt gggtttgctt cagagaaatc aaaaggatag aatggacttt      1260
     gaagcatttt tcagccatcc tttccttgag caagttccag ttaaaaaatc ttgcccagtc      1320
     ccagtgcctg tgtattctgg ccctgtccct ggaagctcct gcagcagctc accatcttgt      1380
     cgctttgctt ctccaccatc ccttccagat atgcagcata ttcaggaaga aaacttatcc      1440
     tccccaccgt tgggtcctcc caactatcta caggtgtcca aagactctgc gagtaatagt      1500
     agcaagaact cttcttgtga cacggatgac tttgttttgg ttccacacaa catctcgtca      1560
     gaccactcat atgacatgcc aatggggact acggccagac gtgcttcaaa tgaattcttt      1620
     atgtgtggag ggcagtgtca acctactgtg tcacctcaca gcgaaacagc cccaattcca      1680
     gttcctactc aagtaaggaa ttatcagcgc atagaacaga atcttatatc cactgccagc      1740
     tctggcacaa acccacatgg ttctccaaga tctgcagtag tacgaaggtc taataccagc      1800
     cccatgggct tcctccgggt tgggtcctgc tcccctgtac caggagacac agtgcagaca      1860
     ggaggacgaa gactctctac tggctcttcc aggccttact caccatcccc tttggttggt      1920
     accattcctg aacagtttag tcagtgctgc tgtggacatc ctcagggcca tgaagccagg      1980
     agtaggcact cctcaggttc tccagtgcca cagacccagg caccacagtc actcttactg      2040
     ggtgctagac tgcagagtgc acccaccctc accgatatct atcagaacaa gcagaagctc      2100
     agaaagcagc actctgaccc tgtgtgtccg tcccatgctg gagctgggta tagttactca      2160
     cctcagccta gtcggcctgg cagccttggg acctctccca ccaagcacac ggggtcctct      2220
     ccacggaatt ctgactggtt ctttaaaact cctttaccaa caatcattgg ctctcctact      2280
     aagactacag ctcctttcaa aatccctaaa acacaagcat cttctaacct gttagccttg      2340
     gttactcgtc atgggcctgc tgaaagccag tccaaagatg ggaatgaccc tcgtgagtgt      2400
     tcccactgcc tctcagtaca aggaagcgag aggcatcgat ctgagcagca gcagagcaag      2460
     gcagtgtttg gcagatctgt cagtactggg aagttatcag aacaacaagt aaaggcacct      2520
     ttaggtggac accagggcag cacggatagt ttaaacacag aacgaccaat ggatgtagct      2580
     cctgcaggag cctgtggtgt tatgctggca ttgccagcag gaacagcagc aagcgccaga      2640
     gctgtcctct tcaccgtggg gtctcctcca cacagtgcca cagcccccac ttgtactcat      2700
     atggtccttc gaacaagaac cacctcagtg gggtccagca gctcaggagg ttccttgtgt      2760
     tctgcaagtg gccgagtatg tgtgggctcc cctcctggac cagggttggg ctcttcccca      2820
     ccaggagcag agggagctcc cagcctaaga tacgtgcctt atggtgcttc accacccagc      2880
     ctagagggtc tcatcacctt tgaagcccct gaactaccag aggagacact gatggagcga      2940
     gagcacacag acaccttacg ccatctgaac atgatgttaa tgtttactga gtgtgtgctg      3000
     gacctgacgg cagtgagggg tgggaaccct gagctgtgca catctgctgt gtccttgtac      3060
     cagattcagg agagtgtagt tgtggaccag atcagccagc taagcaaaga ttgggggcgg      3120
     gtggagcagc tggtgttgta catgaaggca gcacagctgc tggcggcttc cctgcatctc      3180
     gccaaagctc aggtcaagtc tgggaagctg agcccatcca tggctgtgaa acaagttgtt      3240
     aaaaatctga atgaaagata caaattctgc atcaccatgt gcaagaaact tacagaaaag      3300
     ctgaatcgct tcttctccga taaacagaga tttattgatg aaatcaacag tgtgactgca      3360
     gagaaactca tctataattg tgctgtggaa atggttcaat ctgcagccct ggatgagatg      3420
     tttcagcaga ctgaagacat cgtttatcgc taccacaagg cagcccttct tttggaaggc      3480
     ttaagtaaga tcctgcagga ccctacagat gttgaaaatg tgcataagta taaatgtagt      3540
     attgaaagaa gattgtcagc actctgctgt agcactgcaa ctgtgtgagt agcaggcttg      3600
     tctgtggact ggcatggaac aggaggtgat acatttggga ttacatcttg gttctgtcac      3660
     ccatcccagg acagtgtggt gactaccaaa gaacaagcag cagcttaaga aggaagaaca      3720
     atacaaaact actacatatt gtagaaaacc tgccttattg gagaagtcac tccccctttc      3780
     ctttctcttc atagaagcag aacaaaaagt tttccacatg gctcaagtta tttgaacctg      3840
     gcaaataata aatgtacctt agaactagca tcataagtac agttattctt gtggataatt      3900
     aaacaggaaa caaagtgagt ggcttcattc agctctctga gcaatacatg aaattccgtg      3960
     ttttgctaaa gcatacacaa gcaaaagcgt atacagctcg tccagacgat ctgaggtttg      4020
     gggtaagttt gtctgaatct gagcctgcat ctttaaacag ctcaggagga ggaatcttaa      4080
     gaagaaacaa aaggtgactc ttggatgaat tgtgaaatct tcaacttgat ctaatgtgga      4140
     catgatttta atcttccaaa aatctttcat attgcactaa tttattaaaa taactgtgta      4200
     ttggattttg caatttaaaa ctaactgagg cacaatggac ttgtttaaat attttacttg      4260
     attatataca tgtccttttc agaattcatg tgtaatctcc actgaacttt taaatggttg      4320
     gaaattgcgt tcatgtgaac ctttgcattt ttctcacctg ttatcttcac caacagatct      4380
     tagtggaatt ttgaaaaaaa aaaaaaaaaa aaa                                   4413
//