spacer

EBI Dbfetch

ID   BC046618; SV 1; linear; mRNA; STD; MUS; 4163 BP.
XX
AC   BC046618;
XX
DT   13-FEB-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus AXL receptor tyrosine kinase, mRNA (cDNA clone MGC:54698
DE   IMAGE:6494383), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4163
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4163
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 44bc0cdc95de2a83462b32d4d28a2397.
DR   Ensembl-Gn; ENSMUSG00000002602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002677; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: p Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542163.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4163
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:54698 IMAGE:6494383"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..4163
FT                   /gene="Axl"
FT                   /note="synonyms: Ark, Tyro7"
FT   CDS             93..2759
FT                   /codon_start=1
FT                   /gene="Axl"
FT                   /product="AXL receptor tyrosine kinase"
FT                   /db_xref="GOA:Q00993"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:1347244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00993"
FT                   /protein_id="AAH46618.1"
FT                   /translation="MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLT
FT                   GTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLS
FT                   DAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPV
FT                   TLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRP
FT                   HHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQV
FT                   SVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNG
FT                   SQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVS
FT                   VTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLGALVAAACV
FT                   LILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELK
FT                   EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDF
FT                   LSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQP
FT                   VFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG
FT                   DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIY
FT                   DYLRQGNRLKQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENTLKALPPAQEPDE
FT                   ILYVNMDEGGSHLEPRGAAGGADPPTQPDPKDSCSCLTAADVHSAGRYVLCPSTAPGPT
FT                   LSADRGCPAPPGQEDGA"
FT   misc_difference 4149..4163
FT                   /gene="Axl"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 4163 BP; 955 A; 1136 C; 1089 G; 983 T; 0 other;
     gggacaaccc ggccctgccc cctttcctag cgaggtgccc atcaacttcg gaagaaagtt        60
     tggcatcaat ctgagctgtt ggtgtctgga ggatgggcag ggtcccgctg gcctggtggt       120
     tggcgctgtg ctgctggggg tgtgcagccc ataaggacac acagaccgag gctggcagcc       180
     cgtttgtggg gaacccaggg aatatcacag gtgccagagg actcacgggg acacttcggt       240
     gtgagctcca ggttcagggg gaaccccctg aggtggtgtg gcttcgagat ggacagatcc       300
     tagaactggc tgataacacc cagacccagg tgcctctggg cgaagactgg caagatgaat       360
     ggaaagttgt cagtcagctc agaatctcag ccctgcaact ttcagatgca ggggagtacc       420
     agtgtatggt gcatctagaa ggacggacct ttgtgtctca gccgggcttt gtagggctgg       480
     aaggtctccc gtacttcctg gaggagcctg aggacaaagc tgtgcctgcc aacacccctt       540
     tcaacctaag ctgccaggcc cagggacccc cggaacccgt gaccctactc tggcttcaag       600
     atgctgtccc cctggcccca gtcacaggac acagctccca gcacagtctg caaactccag       660
     gcctgaacaa gacatcttct ttctcatgtg aagcccacaa tgccaaggga gtcaccacct       720
     cccgcacagc caccatcaca gtgctccccc agaggcctca ccatctccac gtggtttcca       780
     gacaacctac ggagctagag gtagcttgga cccctggcct gagtggcatc tacccgctca       840
     cccactgcaa cctgcaggcc gtgctgtcag acgatggggt gggtatctgg ctgggaaagt       900
     cagatcctcc tgaagacccc ctcaccttgc aagtatcagt gcccccccac cagcttcggc       960
     tggaaaagct ccttcctcac accccgtatc acatccggat atcctgcagc agcagccagg      1020
     gcccctcacc ttggacccac tggcttcctg tggagaccac agagggagtg cccttgggtc      1080
     cccctgagaa cgttagcgcc atgcggaatg ggagccaggt cctcgtgcgt tggcaggagc      1140
     caagggtgcc cctgcaaggc accctgttag ggtaccggct ggcatatcga ggccaggaca      1200
     cccccgaggt acttatggat atagggctaa ctcgagaggt gaccttggaa ctgcgggggg      1260
     acaggcctgt ggctaacctg actgtgtctg tgacagccta tacctcggct ggggatgggc      1320
     cctggagcct tcctgtgccc ctagagccct ggcgcccagg gcaaggacag ccactccacc      1380
     atctggtgag tgaaccccca cctcgcgcct tctcgtggcc ttggtggtat gtactgctgg      1440
     gagcacttgt ggctgccgcc tgcgtcctca tcttggccct gttccttgtc catcggagga      1500
     agaaggagac tcgatatggg gaggtgtttg agccaaccgt ggaaagaggt gaactggtag      1560
     tcaggtaccg tgtccgaaag tcctacagcc ggcggaccac tgaagccacc ttgaacagtc      1620
     tgggcatcag tgaagagctg aaggagaaac tacgagacgt catggtagat cggcataagg      1680
     tggccttggg gaagaccctg ggagaaggag aatttggcgc tgtgatggaa ggtcagctca      1740
     atcaggatga ctccatcctc aaggtcgctg tgaagaccat gaaaattgcc atctgcacaa      1800
     gatcagagct ggaggatttc ctgagtgaag ctgtctgcat gaaggaattt gaccacccca      1860
     acgtcatgag gctcattggc gtctgttttc agggctctga cagagagggt ttcccagaac      1920
     ctgtggtcat cttgcctttc atgaaacacg gagacctaca cagtttcctc ctgtactccc      1980
     ggctcgggga ccagccagtg ttcctgccca ctcagatgct agtgaagttc atggccgaca      2040
     ttgccagtgg tatggagtac ctgagtacca agagattcat acatcgggac ctggctgcca      2100
     ggaactgcat gctgaatgag aacatgtccg tgtgtgtggc agacttcggg ctctccaaga      2160
     agatctacaa cggggattac taccgccaag ggcgcattgc caagatgcca gtcaagtgga      2220
     ttgctattga gagtctggca gatcgggtct acaccagcaa gagcgatgtg tggtccttcg      2280
     gtgtgacaat gtgggagatc gccacccgag gccaaactcc ctatccaggg gtggagaaca      2340
     gtgagattta cgactacctg cgtcaaggaa atcggctgaa acagcctgtg gactgtctgg      2400
     acggcctgta tgccctgatg tctcggtgct gggaactgaa ccctcgagac cggccaagtt      2460
     ttgcggagct ccgggaagac ttggagaaca cactgaaggc tctgccccct gctcaggagc      2520
     cagatgaaat cctctatgtc aacatggatg agggcggaag ccaccttgaa ccccgtgggg      2580
     ctgctggagg agctgacccc ccaacccaac ctgatcctaa ggattcctgt agctgtctca      2640
     ctgcagctga cgtccactca gctggacgct atgtcctttg tccttctaca gccccaggac      2700
     ccactctgtc tgctgacaga ggctgcccag cacctccagg gcaggaggac ggagcctgag      2760
     acaatcttcc acctgggaca tcctctcagg acccaagcta ggcactgcca ctgggggaaa      2820
     gctcaccccc ccactccgtc actccaggcc ttctccccag atgcagaatg gccttccctc      2880
     ccttctcaga tgcagtccat gccttatgca ccctatccat aacagtttca agggatcgtc      2940
     tcacatcttc catcccagcg ttctagattt taaggtttga gtttagagtt caaagttctc      3000
     aaagatgatg agtctttgga ccgagatgct tgtttctagg tctgcagcgc tgttgctata      3060
     gacaggccca ctgctcgaag gctctgagat tctatggctc tagatttttc tggctctata      3120
     attcgtggca atgctcccat ggttttaggt tgcacgactc tgagattcca ggacctaagg      3180
     cttctagact ttatttttct ggagccaggg gtcctgtcag tggaagattg tagattttta      3240
     aattctaaag attctaggca tgaaggttct aaggcatact gcttctccag tttaacagtt      3300
     tagggctcat gttggaatac tccagatcat aatgtttcaa acttttattt tttttaattt      3360
     ctaagacccc agtgatggtc aactacagat tctgaagcct tatgaccata gattctttta      3420
     tataaaaatc ctgtatctca aggaaatatg attctagact ctgaaattcc aaagctttaa      3480
     gagtctccag atggagtttc taagctatga tgtggtgata atctaaagtt tagtccaagg      3540
     ttctagattc ctaagcttcc acgtcatctg ctcccaggat tccagattat taaactctaa      3600
     aactctaatg ttggcctgat cttcgtctca ggccctgtag gatgctgtgg gtcctcagca      3660
     tctaagtcac aagaggctcc agttaacgag gactaatgag acaccaaagt tctaaccact      3720
     tctaatgctg gacacctcta ggttctatgc tgctttttgc ctttctagca cataattaaa      3780
     tgcccaagaa tacatatgtc taaagatctt aaatctctaa gcactatgga gccaatgttt      3840
     tgagtgtctg agattctaaa ggtccacagt ctagagtatt aggtacgact ccaagggtgg      3900
     gcgcttgtag ccatcctaag tcctttccct ccttaagcac ctatgctcct cctctccttg      3960
     tgtggggtac accccacctt aagcctgtgc gatgcactgg gaatgcctgc tttcctccaa      4020
     gggatgggtc atctcccctc atttggggcc atgttgcccc ttgagccagt cccctatgcc      4080
     tgttctgaag tgtggactct ggtgcctcca gagaggctca gatcacataa aacttttgtc      4140
     agtcactaaa aaaaaaaaaa aaa                                              4163
//


spacer
spacer