spacer

EBI Dbfetch

ID   BC046610; SV 1; linear; mRNA; STD; MUS; 2991 BP.
XX
AC   BC046610;
XX
DT   13-FEB-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus endoplasmic reticulum aminopeptidase 1, mRNA (cDNA clone
DE   MGC:54451 IMAGE:6397585), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2991
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2991
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 44bc2771b5de4f0aed07b176be54de8f.
DR   Ensembl-Gn; ENSMUSG00000021583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169114; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 100 Row: h Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542148.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2991
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="MGC:54451 IMAGE:6397585"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2991
FT                   /gene="Erap1"
FT                   /note="synonyms: ERAAP, PILSA, PILSAP"
FT   CDS             82..2874
FT                   /codon_start=1
FT                   /gene="Erap1"
FT                   /product="endoplasmic reticulum aminopeptidase 1"
FT                   /db_xref="GOA:Q9EQH2"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="MGI:MGI:1933403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQH2"
FT                   /protein_id="AAH46610.1"
FT                   /translation="MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPE
FT                   YMTPIHYDLMIHANLSTLTFWGKTEVEIIASRPTSTIIMHSHHLQISKATLRRGAGEML
FT                   SEEPLKVLEYPAHEQVALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEM
FT                   RILAATQFEPTAARMAFPCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIE
FT                   DHFDITVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEF
FT                   YEDYFNIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIV
FT                   SHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEV
FT                   DALNSSHPVSTPVENPAQIREMFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYS
FT                   YKNTKNEDLWNSMMHICPTDGTQTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQK
FT                   GFPLITITVSGRNVHMKQEHYMKGSERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTD
FT                   VLILPEAVQWIKFNVGMNGYYIVHYADDGWASLSGLLKEAHTTISSNDRASLINNAFQL
FT                   VSIEKLSIEKALDLTLYLKNETEIMPIFQALNELIPMYKLMEKRDMIEVETQFKDFLLK
FT                   LLKDLIDKQTWTDEGSVSERMLRSQLLLLACVRNYQPCVQRAERYFREWKSSNGNMSIP
FT                   IDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFK
FT                   GEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQF
FT                   STRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL
FT                   "
FT   misc_difference 2969..2991
FT                   /gene="Erap1"
FT                   /note="polyA tail: 23 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2991 BP; 910 A; 615 C; 658 G; 808 T; 0 other;
     ggcggccaga ctggcggctg tgatgaaggt aatttgagca agaagatagt gtctctgctc        60
     ctcaaatagc cacttgcaag catgccctct cttcttcccc tagtattgac atttttatct       120
     gtgtcatctc cttcttggtg tcagaacagt gatatagaat ctctaaaagc tagtaatgga       180
     gactcattcc cttggaataa tatgcgactt cctgagtata tgaccccgat tcattatgat       240
     ctcatgatcc atgcaaacct cagcactctg actttctggg gaaaaacaga agtagaaatc       300
     atagctagcc ggcccaccag caccattatt atgcatagtc accacctgca aatatctaag       360
     gccaccctca gaagaggagc tggagagatg ctgtctgaag aaccactgaa ggtcctggaa       420
     tatcctgctc atgagcaagt tgcactgctg gctgcccagc cgcttcttgc tgggtccctg       480
     tacacagtta tcatcgacta tgctgccaac ctgtctgaga gtttccatgg attctataag       540
     agcacctaca gaacacagga aggtgaaatg agaatacttg cagcaacaca gtttgaaccc       600
     acagctgcta gaatggcttt tccctgcttt gatgaacctg ccctcaaggc aagtttttcc       660
     atcaagataa agagggatcc aaggcacctg gccatctcca acatgcccct ggtgaaatct       720
     gtgaatgttg ctgaaggact catagaagac cattttgaca tcactgtgaa gatgagtacc       780
     tacctagtgg ccttcatcat ttctgatttt aagtctgtga gcaagatgac taagagtgga       840
     gtcaaggttt ctgtgtatgc tgtgccagac aagataaatc aagccgatta tgctctggat       900
     gctgcagtga ctcttctaga gttttatgag gattatttca acattccata tcctttaccc       960
     aagcaagatc ttgctgcaat cccagacttt cagtctggtg ctatggaaaa ctggggactg      1020
     accacataca gagagtcctc tctgttatac gataaagaaa agtcttctgc atctagtaag      1080
     cttggcatca caatgattgt gtcccatgaa ctggctcacc agtggttcgg gaacctggtc      1140
     accatggaat ggtggaatga cctttggctc aatgaaggat ttgccaaatt tatggagttt      1200
     gtgtctgtca ctgtgaccca tcctgaacta aaagttgaag actatttctt tggcaagtgt      1260
     tttaatgcaa tggaagttga tgcattaaac tcctctcacc ctgtatccac acctgtggag      1320
     aatcctgcgc agattcggga gatgtttgat gatgtttctt atgaaaaggg agcttgtatt      1380
     ctgaatatgc taagagatta tctgagtgca gatacattta aaagaggaat tgtacagtat      1440
     ctccaaaagt atagttataa aaacacaaaa aacgaggacc tgtggaatag catgatgcat      1500
     atttgcccta cagatggcac acaaacaatg gatggcttct gctctagaag ccaacactca      1560
     tcatcaacct cacactggcg tcaggaggtt gtagatgtaa agaccatgat gaacacatgg      1620
     acactgcaga agggctttcc tctgataacc atcactgtga gtgggcggaa tgtgcacatg      1680
     aagcaagaac actacatgaa gggttcagaa cgcttcccag agactgggta tttgtggcat      1740
     gttccactga cattcattac cagcaaatca gactcagtcc agagattttt gctgaagaca      1800
     aagacagatg tgctcatcct cccagaagca gtgcagtgga tcaaatttaa cgtgggaatg      1860
     aatggctatt acattgtgca ttacgcggat gatggatggg cttctctgag tggcctttta      1920
     aaagaagcgc acacaacaat cagcagtaat gatcgggcaa gtctcatcaa caatgcattt      1980
     cagctggtca gcattgaaaa gttatcaata gaaaaagccc tggatttaac cctgtacttg      2040
     aaaaatgaaa ctgaaattat gcccatattc caagctttga atgaactcat acctatgtat      2100
     aagttaatgg agaaaagaga tatgattgag gtggaaactc aatttaagga cttccttctc      2160
     aagttgctga aggaccttat tgataagcag acttggacag atgaaggctc tgtctcagag      2220
     aggatgctca ggagccagct cctcctcctc gcatgtgtgc gcaattatca gccctgtgtg      2280
     cagagggcag agcgctattt cagagagtgg aagtcatcta atggaaacat gagcatccct      2340
     attgatgtga ccttggctgt gtttgctgtc ggggcccaaa acacagaagg ctgggatttt      2400
     ctttatagta aatatcagtc ttctttgtct agtactgaga aaagccaaat tgaattttcc      2460
     ctctgtacaa gcaaagatcc agaaaaactt cagtggcttc tagatcaaag ttttaaggga      2520
     gagataataa aaactcagga atttccacat attctcacac tcattggcag aaacccagtg      2580
     ggttatccat tggcctggaa gtttctgagg gaaaattgga ataagcttgt acagaaattt      2640
     gaacttggct catcgtccat agctcacatg gtaatgggaa caacagacca gttttccacc      2700
     agagcacgtc ttgaagaggt aaaaggattc ttcagttcct tgaaagaaaa cggttctcag      2760
     ctccgttgtg ttcaacaaac cattgagacc attgaagaaa acatacgatg gatggataag      2820
     aattttgata aaataagact gtggctgcaa aaagaaaagc cagagttgct gtgacaatat      2880
     gtttcttgcc aagttccaga atttatgatg agcaaaattt tgttcaattt gagtattttt      2940
     aaactaaaga tagttgtttt ggctactaaa aaaaaaaaaa aaaaaaaaaa a               2991
//


spacer
spacer