Dbfetch

ID   BC046524; SV 1; linear; mRNA; STD; MUS; 3642 BP.
XX
AC   BC046524;
XX
DT   05-FEB-2003 (Rel. 74, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus septin 9, mRNA (cDNA clone MGC:51657 IMAGE:5290621), complete
DE   cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3642
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3642
RA   Strausberg R.;
RT   ;
RL   Submitted (03-FEB-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 08efaa4e8cc3dcbaa843a44a470bed3e.
DR   Ensembl-Gn; ENSMUSG00000059248; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019446; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019414; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019384; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019389; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019195; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019838; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018749; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019166; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019278; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019270; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019348; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019303; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019877; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018514; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018801; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000019038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106349; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033790; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0033724; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0033714; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033718; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033498; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034218; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033365; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0033412; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0033555; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0033550; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0033688; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033559; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034264; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033060; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032970; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Chu-Xia Deng Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 92 Row: m Column: 6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3642
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="129,C57BL/6J,FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam3"
FT                   /clone="MGC:51657 IMAGE:5290621"
FT                   /tissue_type="Mammary tumor. Brca1-/fl; MMTV-Cre model. 10
FT                   months old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3642
FT                   /gene="Sept9"
FT                   /note="synonyms: Sint1, MSF1, PNUTL4"
FT   CDS             95..1846
FT                   /codon_start=1
FT                   /product="Sept9 protein"
FT                   /db_xref="GOA:Q80UG5"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="InterPro:IPR030645"
FT                   /db_xref="MGI:MGI:1858222"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UG5"
FT                   /protein_id="AAH46524.1"
FT                   /translation="MKKSYSGVTRTSSGRLRRLADPTGPALKRSFEVEEIEPPNSTPPR
FT                   RVQTPLLRATVASSSQKFQDLGVKNSEPAARLVDSLSQRSPKPSLRRVELAGAKAPEPM
FT                   SRRTEISIDISSKQVESTASAAGPSRFGLKRAEVLGHKTPEPVPRRTEITIVKPQESVL
FT                   RRVETPASKIPEGSAVPATDAAPKRVEIQVPKPAEAPNCPLPSQTLENSEAPMSQLQSR
FT                   LEPRPSVAEVPYRNQEDSEVTPSCVGDMADNPRDAMLKQAPASRNEKAPMEFGYVGIDS
FT                   ILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEI
FT                   KSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKK
FT                   RIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVYFKQR
FT                   ITADLLSNGIDVYPQKEFDEDAEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTK
FT                   WGTIEVENTTHCEFAYLRDLLIRTHMQNIKDITSNIHFEAYRVKRLNEGNSAMANGIEK
FT                   EPEAQEM"
FT   misc_feature    974..1810
FT                   /note="GTP_CDC; Region: Cell division protein. Members of
FT                   this family include CDC3, CDC10, CDC11 and CDC12/Septin.
FT                   Members of this family bind GTP"
XX
SQ   Sequence 3642 BP; 867 A; 1076 C; 980 G; 719 T; 0 other;
     cccgcccttc ggcgacccgg attagccacc tgggagcccg cgccccgcgg cctcgccacc        60
     acactttcct gggagcggcg gccacggcgg caccatgaag aagtcctact caggagtcac       120
     acggacctcc agcggtcgcc tccggaggct tgcggatccc actggcccag ccttaaagag       180
     atcgtttgaa gtcgaggaga ttgagccgcc caactccacg ccaccccgga gggtccagac       240
     ccctctgctc cgcgccacgg tggccagctc cagccagaaa ttccaggacc tgggggtgaa       300
     gaactcagag cccgctgccc gccttgtaga ctccctgagc cagcgctccc ccaagccttc       360
     cctgcggagg gtggagctgg cgggagccaa ggcgcctgag cccatgtctc gacgcacaga       420
     gatctccatc gacatctcct ccaagcaggt ggagagcacg gcctccgctg ccgggccctc       480
     acggttcggc cttaagaggg ctgaagtcct gggccacaag accccagagc ctgtccctcg       540
     gaggacggag atcaccattg tcaagcctca ggagtcagtg ctccgcaggg tggagacccc       600
     tgcctccaag attcccgagg gctctgccgt gcctgccaca gatgcagccc ccaagagggt       660
     agagatccag gtgcccaagc cagctgaggc acccaactgt ccgctcccgt cccagaccct       720
     ggagaactcc gaggccccga tgtctcaact gcagagcagg ctggagccca ggccttccgt       780
     ggctgaggtc ccatatcgga accaggaaga ctccgaggtg actcccagct gtgttggcga       840
     catggctgac aaccctagag atgccatgct caagcaggcc cccgcgtcac ggaacgaaaa       900
     ggcccccatg gagttcggct atgtggggat cgactccatc ctggagcaga tgcgcaggaa       960
     ggctatgaaa cagggcttcg agtttaacat catggtggtt gggcagagcg gcctcgggaa      1020
     gtccacttta atcaataccc tcttcaagtc caaaatcagc cggaagtcgg tgcagcccac      1080
     ctcggaggaa cgcatcccca agacgatcga aatcaagtcg atcacccacg atattgaaga      1140
     gaagggggtt cgaatgaagc tgacagtgat tgacacgccg ggcttcggag accacatcaa      1200
     caatgagaac tgctggcagc ccattatgaa gttcatcaat gaccaatatg agaagtacct      1260
     gcaggaggaa gtcaacatca accggaagaa gcgcattccc gacacccgtg tccactgctg      1320
     cctctacttc atcccagcca ccggccactc gctcaggccc ctggacattg aattcatgaa      1380
     gcgcctaagc aaagtggtga acattgtccc agtcatcgcc aaggctgaca cgctgaccct      1440
     ggaggagagg gtctacttca aacagcggat cactgcagac ctgctgtcca acggcattga      1500
     cgtgtacccg cagaaggagt ttgatgagga cgcagaagac cggctggtga acgaaaagtt      1560
     ccgggagatg atcccatttg ctgtggtggg cagcgaccat gagtatcaag tcaatggcaa      1620
     gaggattctg ggaaggaaga ccaagtgggg cactatcgaa gttgagaata ccactcactg      1680
     tgaatttgct tacctgcggg atctccttat caggacgcac atgcaaaaca tcaaagacat      1740
     caccagcaac atccacttcg aagcctaccg agtgaaacgc ctcaacgagg gcaacagcgc      1800
     catggccaac gggatcgaga aggagccgga agcccaggag atgtagatgc gtcccgcccc      1860
     tggaccccac ccccagatct tttcatcatc cctggcccac ccacctaccc tgtcttattt      1920
     tatataatta tctccttgtc acctgcctcc atccatctct tcccacactt tgccaggtaa      1980
     caagagaggg tttacctccc aagtgtgctc ttattggctg cagcagcagg gtgggcgggg      2040
     ctaagcctgg gcttgcctct gtgctctatt tccacccggg ctcagcccct gaggggttag      2100
     aagagctatg tgtccgtccc ccgctctgag ttctaagctg aagcctgtgg gggccaagtc      2160
     ctagggggtg cagaggagcc cgttagacca caagacccca tggccgcagc ctcaagcagg      2220
     ttagagactg ccccaaagga ggatggagct ggccgggtat tcctgaaacc tcacctgccc      2280
     ctccgggggc gtttcttaca gcgccctcag ctgcctgccc ctcaagggaa ctagaggcgt      2340
     cacagccaaa gttgccaatc acttagacaa agtgacaacc gtgcccctcg agcttgtccc      2400
     agagcagaaa gtgccttgat ctacaagagc cagtcacctc ttcccagatg tccctttggg      2460
     tgaaaagcag ggacgtgctg gagagaggga ggtatctttt ctccctcgcc cttgggttct      2520
     ctctcccctg tgctgtagat atcgctacta cactgggctt taattataaa agacgaagcg      2580
     tgaaagatgc tccccgatgt taggaagccc cgcccccaat gtaaggaagg tcaaagcaag      2640
     aagatgagtc gaagccatga gggaggaagc cgtggaaggg aggcataaga gtgtgtggga      2700
     gctctcctgc ccaggtgccg cggaaggcat atccgcgtgg tcctcagttt gggccaagat      2760
     attctggtta cattgatgct ccgctgcctc accctgtccc accccacaca ccccaggctc      2820
     aagccttgat gattcagtga ctgtactggg tgggagccag aaacctgacc attttgttgt      2880
     ctacatgagc ctagactagc cctgtgcccc agaacccatc aaaaataccc ctaaagaggg      2940
     aaagatgagg gggtcagaga tggatagcca ggctcactca tcttctctca gagggaacat      3000
     tagggaccat ccatgcacag ctgaccaaag ccgtgtcctt cctgcctgcc tcccattctc      3060
     atttgcccct gaggagaaag tttggtgagg tgcgttaggt tggacccgct tggggaaggt      3120
     gcctctacag acccagggct agctttctgc agcccagaag tgcagtggga ggggtggggt      3180
     gcagacagat ggagacgaac attgtttcct gctttgggcg tctactccct catccaagca      3240
     tggaagggcc cctcgtcatg ccctgtggcc gaacagttcg cttgccagct tgccaagttc      3300
     ttttgccaaa atcaggactt tgaaggaaat ctccagcacg ctggacccag ggcactccgg      3360
     ccttcaccag cccaagtgac cctggggatt tagcagcaac ccggtcatca ggatgacttt      3420
     gtgcctctgt aaccaggtat tgaaactgtt cgtctcacca ggccggtcca cgtggccctc      3480
     tgctgggggc ttcctggtgg gggggcagaa aagtctctct ctctctctct ctctctcttt      3540
     tttttttttt ttgtataaat aacaaagtgt tgaaatgtat ttcctgaaat aaatgtttca      3600
     aatacaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa                         3642
//