spacer

EBI Dbfetch

ID   BC046225; SV 1; linear; mRNA; STD; MUS; 1095 BP.
XX
AC   BC046225;
XX
DT   14-FEB-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus cofilin 1, non-muscle, mRNA (cDNA clone MGC:57897
DE   IMAGE:5691650), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1095
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1095
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JAN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 620eb564851be2ddee5df7a1b60574fa.
DR   Ensembl-Gn; ENSMUSG00000056201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116560; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542381.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1095
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EM0"
FT                   /clone="MGC:57897 IMAGE:5691650"
FT                   /tissue_type="Brain, day 18.5pc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1095
FT                   /gene="Cfl1"
FT                   /note="synonym: cofilin"
FT   CDS             41..541
FT                   /codon_start=1
FT                   /gene="Cfl1"
FT                   /product="cofilin 1, non-muscle"
FT                   /db_xref="GOA:P18760"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR027234"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="MGI:MGI:101757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18760"
FT                   /protein_id="AAH46225.1"
FT                   /translation="MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK
FT                   NIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFW
FT                   APENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEG
FT                   KPL"
FT   misc_difference 837^838
FT                   /gene="Cfl1"
FT                   /note="1 base in the mouse genome, T, is not found in
FT                   cDNA."
FT   misc_difference 1079..1095
FT                   /gene="Cfl1"
FT                   /note="polyA tail: 17 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1095 BP; 281 A; 306 C; 259 G; 249 T; 0 other;
     cttcagttgc tctttctgtc tccctttcgt ttccggaaac atggcctctg gtgtggctgt        60
     ctctgatggt gtcatcaagg tgttcaatga catgaaggtt cgcaagtctt caacaccaga       120
     agaagtgaag aaacgcaaga aggcggtgct cttttgcctg agtgaggaca agaagaacat       180
     catcctggag gagggcaagg agatcctggt aggagatgtg gggcagactg tggacgaccc       240
     ctacaccact tttgtcaaga tgctgccaga caaggactgc cgctatgcac tctatgatgc       300
     aacctatgag accaaggaga gcaagaagga ggacctggtg ttcatcttct gggcccccga       360
     gaatgcaccc ctcaagagca aaatgatcta tgccagctcc aaggatgcca tcaagaagaa       420
     gctgacagga atcaagcatg aattacaagc taactgctac gaggaggtca aggaccgctg       480
     caccctggca gagaaactag gtggcagcgc cgtcatttcc ctggagggca agcctttgtg       540
     agccacctcc agccccctgc ctggagcatc ttaacagccc cagacctgct cttgggtgtt       600
     gcaggctgcc cctttcctgc cagaccggag gggctggggg gatcccagca gggggagggc       660
     tatcccttca ccccagttgc caaacatccc tcccaccccc tggaccgtcc ttctccctcc       720
     atccctgacg gttctggcct tcccaaactg cttttgatct tctgattcct cttgggttga       780
     cgcagaccaa gtcccgtcct aggcacccag tttgggggga gcctgtattt tttttttaac       840
     gacaccccta ctccgtatcc ctccccatcc catgctgcca acttctaacc acaatagtga       900
     ctctgtgctt gtctgtttag ttctgtgtgt aaatgaaatg tggaaatgac cctccctgcc       960
     ccagctggct gccctcccct ttcctttgat cttgaccact catggaagca ggaccagtaa      1020
     gggaccttca atttaaaaca aaacaaaaca aaaaaacaat aaaaaggcta attaacaaaa      1080
     aaaaaaaaaa aaaaa                                                       1095
//


spacer
spacer