Dbfetch

ID   BC043130; SV 1; linear; mRNA; STD; MUS; 2685 BP.
XX
AC   BC043130;
XX
DT   22-MAR-2003 (Rel. 75, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus glycoprotein m6a, mRNA (cDNA clone MGC:58070 IMAGE:6810388),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2685
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2685
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (09-JAN-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f7659f1bf379e8d55791dbadcbcf4810.
DR   Ensembl-Gn; ENSMUSG00000031517; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033615; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033597; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033522; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033594; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033303; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034110; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032629; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033282; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033435; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033376; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033523; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033420; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034128; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032337; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032745; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033915; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0088875; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0088963; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088889; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0088906; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0088464; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089426; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089009; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0088416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0088608; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0088448; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0088636; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0088488; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0089717; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088429; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0087508; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981997.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2685
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FW0"
FT                   /clone="MGC:58070 IMAGE:6810388"
FT                   /tissue_type="Brain, mouse, 13.5, 14.5, 16.5, 17.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..2685
FT                   /gene="Gpm6a"
FT                   /note="synonyms: MGC38999, M6A"
FT   CDS             367..1203
FT                   /codon_start=1
FT                   /gene="Gpm6a"
FT                   /product="glycoprotein m6a"
FT                   /db_xref="GOA:P35802"
FT                   /db_xref="InterPro:IPR001614"
FT                   /db_xref="InterPro:IPR018237"
FT                   /db_xref="MGI:MGI:107671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35802"
FT                   /protein_id="AAH43130.1"
FT                   /translation="MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCG
FT                   CGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGF
FT                   FTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICR
FT                   NTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAG
FT                   AAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT"
FT   misc_difference 2277^2278
FT                   /gene="Gpm6a"
FT                   /note="1 base in the mouse genome, G, is not found in
FT                   cDNA."
FT   misc_difference 2662..2685
FT                   /gene="Gpm6a"
FT                   /note="polyA tail: 24 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2685 BP; 764 A; 521 C; 548 G; 852 T; 0 other;
     ttttaaatgc aaagcgaggc ttgtgaatca cagtgtctct gctcctagaa tccagacccc        60
     tttccactcc ccctcccaaa attatccggc tgtttgtttg agtacctgct tactgtggca       120
     cacacaatgg gcagctttga gaagaaaaat tgataatctt cacggaagag taatttgaat       180
     gaaattacac ttgacagcca gtctctaagc aaacaagagg cgcgagggag cctcagctaa       240
     gctccaagga cttgcccaag ccactgctgc tggagctgcc cagggaaaaa aggcacacgc       300
     ttttttgaca tctaattgag cttttgacta ataccgtgcg ccagattctc ctgaagaaag       360
     gtagccatgg aagagaatat ggaagaagga cagacacaga aagggtgctt cgagtgctgc       420
     attaaatgcc tgggaggtat tccctatgct tctctgattg caaccatcct gctgtatgca       480
     ggcgttgccc tgttctgtgg ctgtggccat gaagcccttt ctggaacagt caacattctg       540
     cagacctact ttgagttggc aaggactgct ggagacacac tggatgtttt cactatgatt       600
     gacatcttta agtatgtgat ctatggcatt gcggctgctt tctttgtcta tggcatttta       660
     ctgatggtag aaggtttctt cacaactggg gctatcaaag atctctatgg agacttcaaa       720
     atcaccacct gtggcagatg tgtgagcgct tggtttatca tgctgacata cctcttcatg       780
     ttggcctggc tgggagtcac agctttcacc tcactgcccg tgtacatgta tttcaatgtg       840
     tggaccatct gccggaacac cactctagtg gagggagcaa atctctgctt ggatctgcgt       900
     cagtttggga ttgtgacaat tggagaggaa aagaaaattt gtactgcctc tgagaacttc       960
     ctgaggatgt gtgaatctac tgagctgaat atgaccttcc acttgttcat tgtggcactt      1020
     gctggagctg gagcagcagt tattgctatg gtccactacc tgatggttct gtctgccaac      1080
     tgggcctatg tgaaagatgc ctgccgcatg cagaagtacg aagacatcaa gtcaaaggaa      1140
     gagcaggagc tgcacgacat ccattctact cgctccaaag agcggctcaa tgcgtacaca      1200
     taaatacgct tctctgttcc ttaccactcg aaggcattgg tgtttcatta agggccatcc      1260
     aaccatccaa cctgtgaaga gcaaaacgag aatgctactc atcaaagatg cgcagggtga      1320
     ctaatgaatc acctgagtat aactctttgc tgttgagcat tccatcttct aatttgttaa      1380
     attggaatga ccaaatctcc tctacaagct cctattcagt cttttttttt aacctctcaa      1440
     attgatttag ttcttctgta tgatcaaaga tattaacatt gtccaacgca aatctttgtt      1500
     tgatttttaa tcacctccca catatcacac ataacacttt ttgcattgtt tcttatgttt      1560
     tggaagagaa aatagctttt tttatacttt ttagttttga tttcagtaac tagtttaact      1620
     acaggtaacc ttcaaaggga ccgttgtaca ttatgaaaga gagacagaga tggtatcatg      1680
     atgactccgc ttgatatggg aatcagtctg gagagatcag tggccacacg gctatcggcc      1740
     atggttaatg ttttcatcca tctaaggtgc aatttcaaaa tttctaaggg taggttaaaa      1800
     aaaagtgctt cttatctttg ttaacattgt attctttttt cttgatgttc gtaaaaggta      1860
     tttctctgat tactcatgtt tatgttgtga gcatgtagaa acagtaatgc taatgcatgg      1920
     ccagttgcct tcctaagatt gtgacaccag gcttaccttt tcaagtttag tatagaaaca      1980
     attatcatgg aaataactac tgtggactgt tggagagtga tctttttttg tgatttatgc      2040
     agtggctgga ttggatcttt taatatgcta atgtggaaaa ttaattacct ttatgaaggt      2100
     ggtatcttaa acataagcac actaaaccct caagacttgt tttacccact taaaactttt      2160
     aacggattgc acctctgtaa gctatttctt aaaatgtgta tgatatattt gaaaagactt      2220
     ccattaatat aatagctttg cttgcagcct tccaatctat gttggtttac ctgtagtttt      2280
     ctaaagggtg gtcagaggcc actagagaat gtattgtttg ggagtgtagt gatatatatt      2340
     ttgtgttttt atttcaagta agtcatttta accaaatgtt cattcacatt catttataag      2400
     aagtacctat atcagacaaa ttttaaaaga aaaacaatca gtattaatgg accaaatttc      2460
     gtgtttgttt taaccttgac tctcttttga ttctttctaa tgctacaaga atgctgtgaa      2520
     atgtcattta aaataatgat gtagcctgac aagaaatttt gtcagtgtat aaacctaggt      2580
     agtattgtgc actgatttga ccattgtgaa ttcctccttc agtgtaagtg cattcccaat      2640
     aaaatttatt gagtgaaaca aaaaaaaaaa aaaaaaaaaa aaaaa                      2685
//